Clone IP21045 Report

Search the DGRC for IP21045

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:210
Well:45
Vector:pOT2
Associated Gene/TranscriptNtf-2r-RA
Protein status:IP21045.pep: gold
Sequenced Size:704

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Ntf-2r 2008-05-05 Release 5.5 slip selected
Ntf-2r 2008-12-18 5.12 accounting

Clone Sequence Records

IP21045.complete Sequence

704 bp assembled on 2008-10-23

GenBank Submission: BT050533.1

> IP21045.complete
CTCTAATCGTACCCCGTATATACTTGAACTAAAATGTCTCTGAATCTGCA
GTACGAGGACATTGGCAAGGAATTTGTCCAGCAGTACTACGCCATATTCG
ATGACCCGGCGAATCGGGAGAACGTGATTAATTTCTATAACGCTACCGAC
TCTTTCATGACCTTTGAAGGCAACCAAATACAGGGAGCACCCAAGATTCT
GGAAAAAGTTCAGAGTCTGAGCTTTCAGAAGATTGCCAGAGTGATAACCA
CAGTGGATTCGCAGCCAACTTCCGATGGCGGAGTTCTGATCATCGTCCTT
GGAAGACTAAAATGCGATGACGATCCCCCACATGCATTCTCGCAGATCTT
TTTGCTGAAGCCCAACGGAGGATCCCTCTTCGTGGCTCACGACATCTTCC
GTCTGAACATCCACAACTCTGCCTAGGAGCACTCCAGACCCATATGTACA
CCACACATAATCGACATCCAAAGACGCCCAGCGCCTAATAGTGATAACAT
GATAACAACAGCACGGCAGTGGGACTCAGAAAAAAGCAAAACAAAGCCAG
CCAACGGTCTCAAGATCGTCAGCGAATACAAAAGTTAATACAAGACAAAC
AAAAAAATAATTAAAAAAAGCTTAGGACTTTTATTTTGAAAACTTTTTCG
AGAAATAAAATAGAAACAAATCTTTTCCCAATTCACAAAAAAAAAAAAAA
AAAA

IP21045.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:11:03
Subject Length Description Subject Range Query Range Score Percent Strand
Ntf-2r-RA 698 Ntf-2r-RA 13..698 1..686 3430 100 Plus
Ntf-2-RA 1297 Ntf-2-RA 205..622 19..436 1595 92.1 Plus
Ntf-2-RB 670 Ntf-2-RB 205..495 19..309 1155 93.1 Plus
Ntf-2-RA 1297 Ntf-2-RA 688..800 499..607 245 84 Plus
Ntf-2-RA 1297 Ntf-2-RA 649..685 449..485 170 97.2 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:31:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 18453432..18454117 1..686 3430 100 Plus
chrX 22417052 chrX 20903903..20904204 313..607 495 80.2 Plus
chrX 22417052 chrX 20901693..20901791 211..309 435 96 Plus
chrX 22417052 chrX 20900756..20900876 19..139 425 90.1 Plus
chrX 22417052 chrX 20901556..20901627 142..213 315 95.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:44:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:31:45
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18454734..18455422 1..689 3445 100 Plus
X 23542271 X 21038746..21039047 313..607 495 80.2 Plus
X 23542271 X 21036536..21036634 211..309 435 96 Plus
X 23542271 X 21035599..21035719 19..139 425 90.1 Plus
X 23542271 X 21036399..21036470 142..213 315 95.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:28:59
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18454734..18455422 1..689 3445 100 Plus
X 23527363 X 21023838..21023961 313..436 455 91.1 Plus
X 23527363 X 21021628..21021726 211..309 435 95.9 Plus
X 23527363 X 21020691..21020811 19..139 425 90 Plus
X 23527363 X 21021491..21021562 142..213 315 95.8 Plus
X 23527363 X 21024027..21024139 499..607 245 84 Plus
X 23527363 X 21023988..21024024 449..485 170 97.2 Plus
Blast to na_te.dros performed on 2019-03-16 13:31:45 has no hits.

IP21045.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:32:54 Download gff for IP21045.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 18453432..18454117 1..686 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:23:18 Download gff for IP21045.complete
Subject Subject Range Query Range Percent Splice Strand
Ntf-2r-RA 1..393 34..426 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:16:09 Download gff for IP21045.complete
Subject Subject Range Query Range Percent Splice Strand
Ntf-2r-RA 1..393 34..426 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 14:40:24 Download gff for IP21045.complete
Subject Subject Range Query Range Percent Splice Strand
Ntf-2r-RA 1..393 34..426 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:14:02 Download gff for IP21045.complete
Subject Subject Range Query Range Percent Splice Strand
Ntf-2r-RA 1..393 34..426 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:55:37 Download gff for IP21045.complete
Subject Subject Range Query Range Percent Splice Strand
Ntf-2r-RA 13..611 1..599 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:16:09 Download gff for IP21045.complete
Subject Subject Range Query Range Percent Splice Strand
Ntf-2r-RA 13..611 1..599 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 14:40:24 Download gff for IP21045.complete
Subject Subject Range Query Range Percent Splice Strand
Ntf-2r-RA 86..771 1..686 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-10-23 18:44:09 Download gff for IP21045.complete
Subject Subject Range Query Range Percent Splice Strand
Ntf-2r-RA 13..611 1..599 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:14:02 Download gff for IP21045.complete
Subject Subject Range Query Range Percent Splice Strand
Ntf-2r-RA 86..771 1..686 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:32:54 Download gff for IP21045.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18454734..18455419 1..686 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:32:54 Download gff for IP21045.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18454734..18455419 1..686 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:32:54 Download gff for IP21045.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18454734..18455419 1..686 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:40:24 Download gff for IP21045.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18454734..18455419 1..686 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:47:05 Download gff for IP21045.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18454734..18455419 1..686 100   Plus

IP21045.hyp Sequence

Translation from 33 to 425

> IP21045.hyp
MSLNLQYEDIGKEFVQQYYAIFDDPANRENVINFYNATDSFMTFEGNQIQ
GAPKILEKVQSLSFQKIARVITTVDSQPTSDGGVLIIVLGRLKCDDDPPH
AFSQIFLLKPNGGSLFVAHDIFRLNIHNSA*

IP21045.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:15:46
Subject Length Description Subject Range Query Range Score Percent Strand
Ntf-2r-PA 130 CG10174-PA 1..130 1..130 672 100 Plus
Ntf-2-PE 130 CG1740-PE 1..130 1..130 594 87.7 Plus
Ntf-2-PA 130 CG1740-PA 1..130 1..130 594 87.7 Plus
Ntf-2-PB 129 CG1740-PB 1..128 1..128 543 82 Plus
Ntf-2-PC 89 CG1740-PC 1..89 42..130 403 87.6 Plus

IP21045.pep Sequence

Translation from 33 to 425

> IP21045.pep
MSLNLQYEDIGKEFVQQYYAIFDDPANRENVINFYNATDSFMTFEGNQIQ
GAPKILEKVQSLSFQKIARVITTVDSQPTSDGGVLIIVLGRLKCDDDPPH
AFSQIFLLKPNGGSLFVAHDIFRLNIHNSA*

IP21045.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 12:10:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21708-PA 165 GF21708-PA 1..165 1..130 556 68.5 Plus
Dana\GF23973-PA 132 GF23973-PA 1..131 1..129 415 58.8 Plus
Dana\GF20049-PA 126 GF20049-PA 1..125 1..126 345 52.4 Plus
Dana\GF17607-PA 692 GF17607-PA 14..128 8..123 165 33.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 12:10:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\Ntf-2-PA 165 GG19703-PA 1..165 1..130 547 67.9 Plus
Dere\GG19770-PA 686 GG19770-PA 14..128 8..123 154 32.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 12:10:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16820-PA 130 GH16820-PA 1..130 1..130 580 81.5 Plus
Dgri\GH12206-PA 165 GH12206-PA 1..165 1..130 541 66.7 Plus
Dgri\GH18527-PA 675 GH18527-PA 14..128 8..123 164 34.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:10:43
Subject Length Description Subject Range Query Range Score Percent Strand
Ntf-2r-PA 130 CG10174-PA 1..130 1..130 672 100 Plus
Ntf-2-PE 130 CG1740-PE 1..130 1..130 594 87.7 Plus
Ntf-2-PA 130 CG1740-PA 1..130 1..130 594 87.7 Plus
Ntf-2-PB 129 CG1740-PB 1..128 1..128 543 82 Plus
Ntf-2-PC 89 CG1740-PC 1..89 42..130 403 87.6 Plus
rin-PG 690 CG9412-PG 14..128 8..123 169 33.3 Plus
rin-PF 690 CG9412-PF 14..128 8..123 169 33.3 Plus
rin-PE 690 CG9412-PE 14..128 8..123 169 33.3 Plus
rin-PB 690 CG9412-PB 14..128 8..123 169 33.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 12:10:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15738-PA 130 GI15738-PA 1..130 1..130 593 84.6 Plus
Dmoj\GI22064-PA 651 GI22064-PA 14..128 8..123 166 34.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 12:10:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16396-PA 165 GL16396-PA 1..165 1..130 539 66.1 Plus
Dper\GL18713-PA 157 GL18713-PA 40..152 13..125 359 58.4 Plus
Dper\GL23542-PA 697 GL23542-PA 14..128 8..123 159 33.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 12:10:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14503-PA 165 GA14503-PA 1..165 1..130 537 65.5 Plus
Dpse\GA25766-PA 130 GA25766-PA 1..125 1..125 391 57.6 Plus
Dpse\GA27297-PA 696 GA27297-PA 14..128 8..123 160 33.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 12:10:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23057-PA 130 GM23057-PA 1..130 1..130 596 86.2 Plus
Dsec\Ntf-2r-PA 130 GM17275-PA 1..130 1..130 590 86.2 Plus
Dsec\GM24117-PA 682 GM24117-PA 14..128 8..123 165 33.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 12:10:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Ntf-2r-PA 130 GD24139-PA 1..130 1..130 607 88.5 Plus
Dsim\Ntf-2-PA 165 GD17509-PA 1..165 1..130 555 68.5 Plus
Dsim\GD18916-PA 669 GD18916-PA 14..128 8..123 165 33.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 12:10:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18599-PA 130 GJ18599-PA 1..130 1..130 596 85.4 Plus
Dvir\GJ24112-PA 651 GJ24112-PA 14..128 8..123 167 34.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 12:10:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25032-PA 129 GK25032-PA 1..129 1..129 594 85.3 Plus
Dwil\GK13947-PA 715 GK13947-PA 14..128 8..123 163 34.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 12:10:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Ntf-2-PA 165 GE17902-PA 1..165 1..130 557 68.5 Plus
Dyak\GE26283-PA 684 GE26283-PA 14..128 8..123 164 33.3 Plus