BDGP Sequence Production Resources |
Search the DGRC for IP21067
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 210 |
Well: | 67 |
Vector: | pOT2 |
Associated Gene/Transcript | CG15422-RA |
Protein status: | IP21067.pep: gold |
Sequenced Size: | 697 |
Gene | Date | Evidence |
---|---|---|
CG15422 | 2008-12-18 | 5.12 accounting |
697 bp assembled on 2008-12-10
GenBank Submission: BT053716.1
> IP21067.complete GTGAAGTTGGTTCGGTTGGCTGGTTGATTATTTGGCTAGTTAATCAACTA TGCGGTACTATGAAGATCCATGTGGCTATCCTCCTCGCCATCACCATGGT CGTCCAAATATCGAAATTGATGTGGTTCCCGGTTGGGGTGGCGGCTACTA TCCGCCGCCGCCTCCGCCTCGGCCCGCCGAGGTAGTCTACATGACCCCGG CGGCTACCTATGTGCCCGGCACACAGGTGATAATGCCGCAACCCTACGGC GGCGTCACGGTGGCCACCACCAATGGATACTATCCGCAGCAGCAGCAGCA GGCGTACGAGTATCAGTACCAGTATCAGCAGCCCTACAACAATCCACCGT ATCCGCAGTGGTGAACGAGGTCGGAATGGAAACGAAGCCATCACCACTAA CAAAAAAAAAATATACTATCGATGGAGTGAAGGAAGGGATAGATAACAAG AAATCAAAACAAATATCACTTTGTCCTAATCTTAAGTTGAAATGACAACG CAAATGGTGCAATGGTCTTGACATTACGCACCACAAAGTTAACAAGTTAA TAACCAGAGGAAGGTACAAAAAAACAAAACTGGAATTTAACTTTAACCGT TTCAAAGAAAATATAATTGTGCTATATAACCTTAAAACGAAATAAATAAA ATATCTTGCTCTTCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15422-RA | 651 | CG15422-RA | 1..651 | 1..651 | 3255 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 4004439..4005104 | 1..664 | 3100 | 98 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 4005007..4005676 | 1..670 | 3350 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 4005007..4005676 | 1..670 | 3350 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2344..2477 | 282..412 | 157 | 61.5 | Plus |
Max-element | 8556 | Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). | 1051..1165 | 657..538 | 119 | 62.6 | Minus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6809..6868 | 287..345 | 117 | 68.3 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6845..6897 | 287..341 | 117 | 73.2 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6734..6846 | 287..402 | 114 | 56.9 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6776..6905 | 287..416 | 108 | 58.6 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6794..6846 | 287..341 | 108 | 69.1 | Plus |
roo | 9092 | roo DM_ROO 9092bp | 1057..1124 | 264..332 | 108 | 63.8 | Plus |
Dvir\Het-A | 6610 | Dvir\Het-A HETAVIR 6610bp | 3369..3393 | 439..463 | 107 | 92 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6755..6810 | 287..341 | 106 | 67.9 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 4004439..4005104 | 1..664 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15422-RA | 1..315 | 50..364 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15422-RA | 1..315 | 50..364 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15422-RA | 1..315 | 50..364 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15422-RA | 1..315 | 50..364 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15422-RA | 1..315 | 50..364 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15422-RA | 24..687 | 1..664 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15422-RA | 24..687 | 1..664 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15422-RA | 24..687 | 1..664 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 4005007..4005670 | 1..664 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 4005007..4005670 | 1..664 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 4005007..4005670 | 1..664 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 4005007..4005670 | 1..664 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 4005007..4005670 | 1..664 | 100 | Plus |
Translation from 49 to 363
> IP21067.pep MRYYEDPCGYPPRHHHGRPNIEIDVVPGWGGGYYPPPPPPRPAEVVYMTP AATYVPGTQVIMPQPYGGVTVATTNGYYPQQQQQAYEYQYQYQQPYNNPP YPQW*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF20686-PA | 97 | GF20686-PA | 1..76 | 1..76 | 281 | 80.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG24977-PA | 102 | GG24977-PA | 1..75 | 1..75 | 291 | 88 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH11532-PA | 103 | GH11532-PA | 1..79 | 1..75 | 178 | 56.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15422-PA | 104 | CG15422-PA | 1..104 | 1..104 | 619 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI17023-PA | 111 | GI17023-PA | 4..111 | 3..104 | 154 | 48.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL18838-PA | 107 | GL18838-PA | 4..78 | 3..75 | 252 | 68.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA13715-PA | 107 | GA13715-PA | 4..78 | 3..75 | 251 | 68.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM18448-PA | 103 | GM18448-PA | 1..103 | 1..104 | 485 | 97.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23265-PA | 103 | GD23265-PA | 1..103 | 1..104 | 488 | 98.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ24516-PA | 99 | GJ24516-PA | 4..99 | 3..104 | 181 | 52.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK23901-PA | 103 | GK23901-PA | 4..71 | 3..70 | 201 | 70 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE18267-PA | 105 | GE18267-PA | 1..73 | 1..73 | 253 | 93.2 | Plus |
Translation from 49 to 363
> IP21067.hyp MRYYEDPCGYPPRHHHGRPNIEIDVVPGWGGGYYPPPPPPRPAEVVYMTP AATYVPGTQVIMPQPYGGVTVATTNGYYPQQQQQAYEYQYQYQQPYNNPP YPQW*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15422-PA | 104 | CG15422-PA | 1..104 | 1..104 | 619 | 100 | Plus |