Clone IP21067 Report

Search the DGRC for IP21067

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:210
Well:67
Vector:pOT2
Associated Gene/TranscriptCG15422-RA
Protein status:IP21067.pep: gold
Sequenced Size:697

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15422 2008-12-18 5.12 accounting

Clone Sequence Records

IP21067.complete Sequence

697 bp assembled on 2008-12-10

GenBank Submission: BT053716.1

> IP21067.complete
GTGAAGTTGGTTCGGTTGGCTGGTTGATTATTTGGCTAGTTAATCAACTA
TGCGGTACTATGAAGATCCATGTGGCTATCCTCCTCGCCATCACCATGGT
CGTCCAAATATCGAAATTGATGTGGTTCCCGGTTGGGGTGGCGGCTACTA
TCCGCCGCCGCCTCCGCCTCGGCCCGCCGAGGTAGTCTACATGACCCCGG
CGGCTACCTATGTGCCCGGCACACAGGTGATAATGCCGCAACCCTACGGC
GGCGTCACGGTGGCCACCACCAATGGATACTATCCGCAGCAGCAGCAGCA
GGCGTACGAGTATCAGTACCAGTATCAGCAGCCCTACAACAATCCACCGT
ATCCGCAGTGGTGAACGAGGTCGGAATGGAAACGAAGCCATCACCACTAA
CAAAAAAAAAATATACTATCGATGGAGTGAAGGAAGGGATAGATAACAAG
AAATCAAAACAAATATCACTTTGTCCTAATCTTAAGTTGAAATGACAACG
CAAATGGTGCAATGGTCTTGACATTACGCACCACAAAGTTAACAAGTTAA
TAACCAGAGGAAGGTACAAAAAAACAAAACTGGAATTTAACTTTAACCGT
TTCAAAGAAAATATAATTGTGCTATATAACCTTAAAACGAAATAAATAAA
ATATCTTGCTCTTCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP21067.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:15:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG15422-RA 651 CG15422-RA 1..651 1..651 3255 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:06:50
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 4004439..4005104 1..664 3100 98 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:44:22 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:06:47
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4005007..4005676 1..670 3350 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:32:42
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4005007..4005676 1..670 3350 100 Plus
Blast to na_te.dros performed 2019-03-16 02:06:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2344..2477 282..412 157 61.5 Plus
Max-element 8556 Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). 1051..1165 657..538 119 62.6 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6809..6868 287..345 117 68.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6845..6897 287..341 117 73.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6734..6846 287..402 114 56.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6776..6905 287..416 108 58.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6794..6846 287..341 108 69.1 Plus
roo 9092 roo DM_ROO 9092bp 1057..1124 264..332 108 63.8 Plus
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 3369..3393 439..463 107 92 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6755..6810 287..341 106 67.9 Plus

IP21067.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:07:38 Download gff for IP21067.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 4004439..4005104 1..664 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:04:06 Download gff for IP21067.complete
Subject Subject Range Query Range Percent Splice Strand
CG15422-RA 1..315 50..364 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:22:09 Download gff for IP21067.complete
Subject Subject Range Query Range Percent Splice Strand
CG15422-RA 1..315 50..364 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:43:23 Download gff for IP21067.complete
Subject Subject Range Query Range Percent Splice Strand
CG15422-RA 1..315 50..364 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:58:13 Download gff for IP21067.complete
Subject Subject Range Query Range Percent Splice Strand
CG15422-RA 1..315 50..364 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-12-10 17:57:33 Download gff for IP21067.complete
Subject Subject Range Query Range Percent Splice Strand
CG15422-RA 1..315 50..364 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:22:08 Download gff for IP21067.complete
Subject Subject Range Query Range Percent Splice Strand
CG15422-RA 24..687 1..664 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:43:23 Download gff for IP21067.complete
Subject Subject Range Query Range Percent Splice Strand
CG15422-RA 24..687 1..664 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:58:13 Download gff for IP21067.complete
Subject Subject Range Query Range Percent Splice Strand
CG15422-RA 24..687 1..664 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:07:38 Download gff for IP21067.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4005007..4005670 1..664 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:07:38 Download gff for IP21067.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4005007..4005670 1..664 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:07:38 Download gff for IP21067.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4005007..4005670 1..664 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:43:23 Download gff for IP21067.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4005007..4005670 1..664 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:53:50 Download gff for IP21067.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4005007..4005670 1..664 100   Plus

IP21067.pep Sequence

Translation from 49 to 363

> IP21067.pep
MRYYEDPCGYPPRHHHGRPNIEIDVVPGWGGGYYPPPPPPRPAEVVYMTP
AATYVPGTQVIMPQPYGGVTVATTNGYYPQQQQQAYEYQYQYQQPYNNPP
YPQW*

IP21067.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:28:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20686-PA 97 GF20686-PA 1..76 1..76 281 80.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:28:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24977-PA 102 GG24977-PA 1..75 1..75 291 88 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 11:28:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11532-PA 103 GH11532-PA 1..79 1..75 178 56.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:35:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG15422-PA 104 CG15422-PA 1..104 1..104 619 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:28:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17023-PA 111 GI17023-PA 4..111 3..104 154 48.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:28:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18838-PA 107 GL18838-PA 4..78 3..75 252 68.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:28:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13715-PA 107 GA13715-PA 4..78 3..75 251 68.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:28:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18448-PA 103 GM18448-PA 1..103 1..104 485 97.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:28:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23265-PA 103 GD23265-PA 1..103 1..104 488 98.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:28:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24516-PA 99 GJ24516-PA 4..99 3..104 181 52.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:28:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23901-PA 103 GK23901-PA 4..71 3..70 201 70 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:28:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18267-PA 105 GE18267-PA 1..73 1..73 253 93.2 Plus

IP21067.hyp Sequence

Translation from 49 to 363

> IP21067.hyp
MRYYEDPCGYPPRHHHGRPNIEIDVVPGWGGGYYPPPPPPRPAEVVYMTP
AATYVPGTQVIMPQPYGGVTVATTNGYYPQQQQQAYEYQYQYQQPYNNPP
YPQW*

IP21067.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:16:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG15422-PA 104 CG15422-PA 1..104 1..104 619 100 Plus