Clone IP21085 Report

Search the DGRC for IP21085

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:210
Well:85
Vector:pOT2
Associated Gene/Transcriptlectin-21Ca-RA
Protein status:IP21085.pep: gold
Sequenced Size:959

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
lectin-21Ca 2008-05-05 Release 5.5 slip selected
lectin-21Ca 2008-08-15 Release 5.9 accounting
lectin-21Ca 2008-12-18 5.12 accounting

Clone Sequence Records

IP21085.complete Sequence

959 bp assembled on 2008-05-14

GenBank Submission: BT032781

> IP21085.complete
ATTTATTCCCTCAAGTTATAGCACTGAATGTTCCAGCACGCAAACTTTTT
TCTGCACGTCTTCATGGCCTGTGGGCTCTATGGAATCCGTGCAAAGGATG
TGTGTCCTCGAATGTCAACGGATAAGGAAGTGTGTCTCGTAGAACTGGCG
CCAGTACTTAAGTATATTTCCAACAACCATAAGAGCCACTGGAACTCTGC
TAACGAAGTCCAAGTGAATGAAACCAGGAAACAACTGGCTAAGATTGAAG
GTCAGGAGAAGGAAACAAACGACAAAATAAAAGTAATTCACGACAATGTG
GATAACGAATTTAATGCTCTAAGTGCGAAGATTAAGAATGTGAAAAATAT
CCAACGTCACTTAGCAAGTCTGGAGTTACAATTGCAAGAAACGAAAAAAG
CCCTAAATCTATCCGTGGAAGCGAAAAAAGTGATGCCGAAAACCGAAATC
CCATCCCAATTTCAGAAGATTGGCTGGAGGCATTTTTTCATCGAGAAGAA
ACACAAAGTGGATTGGTTTAAAGCGACAAGCATGTGCCATAAAATGGGTG
CTCATCTGTTGACAATCCAGAGCGAAGACGAATTGGATGCTATCCGTACG
GAACTTAAGGACATCAATGACGGAAGTCACGACTTCTGGCTGGACATCAA
TGACATTGCTAAGTGGGGCGAATTCATTTCTTTAGCAACGGGAATGAATC
CACCCTTTTTGAAATGGCATAAACATAGGCCTCAGGTGCAAATTCATCAG
CGCTGTGTTCACTTACGTGGAGGAGAAATGATGGATGGAAAGTGCAGCGA
ACAGTTTCTTTTTATTTGCCAGCTTGCAGTAAATTAAAAGATTTTACAAT
GTACAAAATTATTGCAGATTTCTTAAAAGCGAAATGATCTCTTACTATTA
TAAGATGTGTAGTAAATACTTAAATTTTTCTACATAAAATAAAAAAAAAA
AAAAAAAAA

IP21085.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:00:29
Subject Length Description Subject Range Query Range Score Percent Strand
lectin-21Ca-RA 810 lectin-21Ca-RA 1..810 28..837 4050 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:01:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 624602..625541 1..940 4550 98.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:44:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:01:21
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 624617..625557 1..941 4705 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:56:20
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 624617..625557 1..941 4705 100 Plus
Blast to na_te.dros performed on 2019-03-16 07:01:22 has no hits.

IP21085.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:02:12 Download gff for IP21085.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 624602..625541 1..940 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:23:30 Download gff for IP21085.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-21Ca-RA 1..810 28..837 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:56:27 Download gff for IP21085.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-21Ca-RA 1..810 28..837 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:59:19 Download gff for IP21085.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-21Ca-RA 1..810 28..837 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:55:34 Download gff for IP21085.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-21Ca-RA 1..810 28..837 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:24:55 Download gff for IP21085.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-21Ca-RA 1..810 28..837 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:20:39 Download gff for IP21085.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-21Ca-RA 1..810 28..837 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:56:27 Download gff for IP21085.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-21Ca-RA 1..940 1..940 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:59:19 Download gff for IP21085.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-21Ca-RA 1..940 1..940 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:55:34 Download gff for IP21085.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-21Ca-RA 1..810 28..837 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:24:55 Download gff for IP21085.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-21Ca-RA 1..940 1..940 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:02:12 Download gff for IP21085.complete
Subject Subject Range Query Range Percent Splice Strand
2L 624617..625556 1..940 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:02:12 Download gff for IP21085.complete
Subject Subject Range Query Range Percent Splice Strand
2L 624617..625556 1..940 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:02:12 Download gff for IP21085.complete
Subject Subject Range Query Range Percent Splice Strand
2L 624617..625556 1..940 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:59:19 Download gff for IP21085.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 624617..625556 1..940 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:33:12 Download gff for IP21085.complete
Subject Subject Range Query Range Percent Splice Strand
2L 624617..625556 1..940 100   Plus

IP21085.pep Sequence

Translation from 27 to 836

> IP21085.pep
MFQHANFFLHVFMACGLYGIRAKDVCPRMSTDKEVCLVELAPVLKYISNN
HKSHWNSANEVQVNETRKQLAKIEGQEKETNDKIKVIHDNVDNEFNALSA
KIKNVKNIQRHLASLELQLQETKKALNLSVEAKKVMPKTEIPSQFQKIGW
RHFFIEKKHKVDWFKATSMCHKMGAHLLTIQSEDELDAIRTELKDINDGS
HDFWLDINDIAKWGEFISLATGMNPPFLKWHKHRPQVQIHQRCVHLRGGE
MMDGKCSEQFLFICQLAVN*

IP21085.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:16:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19731-PA 235 GF19731-PA 8..232 34..265 283 33.9 Plus
Dana\GF15691-PA 176 GF15691-PA 53..173 145..267 254 41.1 Plus
Dana\GF15692-PA 176 GF15692-PA 51..173 143..267 254 40.5 Plus
Dana\GF15878-PA 212 GF15878-PA 85..209 138..265 248 37.7 Plus
Dana\GF15345-PA 204 GF15345-PA 42..198 88..265 240 32.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:16:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24734-PA 269 GG24734-PA 1..269 1..269 1178 81 Plus
Dere\GG21745-PA 255 GG21745-PA 41..248 36..265 316 34.3 Plus
Dere\GG10476-PA 282 GG10476-PA 1..277 1..265 306 32.9 Plus
Dere\GG24634-PA 172 GG24634-PA 7..172 93..267 305 37.1 Plus
Dere\GG24559-PA 1288 GG24559-PA 41..255 36..265 294 33.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:16:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23701-PA 385 GH23701-PA 177..380 69..265 231 29.6 Plus
Dgri\GH11271-PA 376 GH11271-PA 246..371 142..265 228 36.6 Plus
Dgri\GH10464-PA 197 GH10464-PA 20..193 105..265 225 32.6 Plus
Dgri\GH22505-PA 106 GH22505-PA 1..103 161..266 177 37.4 Plus
Dgri\GH13620-PA 176 GH13620-PA 41..165 145..265 167 29.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:11:49
Subject Length Description Subject Range Query Range Score Percent Strand
lectin-21Ca-PA 269 CG2826-PA 1..269 1..269 1441 100 Plus
CG2839-PA 826 CG2839-PA 1..267 1..269 392 32.7 Plus
lectin-21Cb-PB 249 CG13686-PB 1..247 1..265 338 32 Plus
CG15358-PE 252 CG15358-PE 39..245 34..265 295 36.1 Plus
CG15358-PD 252 CG15358-PD 39..245 34..265 295 36.1 Plus
lectin-22C-PB 263 CG42295-PB 1..255 1..265 284 31.7 Plus
lectin-28C-PC 265 CG7106-PC 45..264 36..269 268 29.4 Plus
lectin-28C-PB 265 CG7106-PB 45..264 36..269 268 29.4 Plus
CG15818-PA 283 CG15818-PA 43..278 34..265 265 31.6 Plus
lectin-29Ca-PA 236 CG17799-PA 1..231 1..265 256 27.9 Plus
lectin-24A-PA 282 CG3410-PA 38..282 36..268 245 28 Plus
lectin-30A-PA 223 CG17011-PA 30..218 59..265 239 30.4 Plus
CG7763-PD 232 CG7763-PD 68..230 104..268 224 30.2 Plus
CG7763-PC 232 CG7763-PC 68..230 104..268 224 30.2 Plus
Acp29AB-PA 234 CG17797-PA 48..229 51..265 218 30.4 Plus
lectin-24Db-PA 359 CG2958-PA 175..354 69..265 216 29.8 Plus
lectin-37Db-PB 150 CG33533-PB 30..149 147..266 183 33.6 Plus
lectin-37Db-PA 150 CG33533-PA 30..149 147..266 183 33.6 Plus
tfc-PC 188 CG9134-PC 56..188 147..269 180 29.3 Plus
tfc-PA 188 CG9134-PA 56..188 147..269 180 29.3 Plus
tfc-PB 376 CG9134-PB 244..376 147..269 180 29.3 Plus
CG12111-PB 188 CG12111-PB 30..174 127..265 176 29 Plus
CG12111-PA 188 CG12111-PA 30..174 127..265 176 29 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:16:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17697-PA 153 GI17697-PA 10..149 117..265 203 31.8 Plus
Dmoj\GI24628-PA 146 GI24628-PA 28..142 147..265 182 31.7 Plus
Dmoj\GI24639-PA 192 GI24639-PA 53..187 119..265 176 27.9 Plus
Dmoj\GI14792-PA 194 GI14792-PA 21..182 112..267 175 27.2 Plus
Dmoj\GI14022-PA 161 GI14022-PA 37..158 148..268 169 31 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:16:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10741-PA 236 GL10741-PA 10..231 6..265 242 27.3 Plus
Dper\GL26175-PA 238 GL26175-PA 99..224 145..267 223 38.5 Plus
Dper\GL19670-PA 282 GL19670-PA 105..274 107..265 222 32.2 Plus
Dper\GL26705-PA 277 GL26705-PA 123..276 106..265 211 28.3 Plus
Dper\GL26845-PA 183 GL26845-PA 54..178 145..267 188 35.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:16:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24466-PA 236 GA24466-PA 44..233 36..267 235 29.3 Plus
Dpse\GA25561-PA 181 GA25561-PA 42..167 145..267 224 38.5 Plus
Dpse\GA29021-PA 141 GA29021-PA 9..132 145..267 214 35.9 Plus
Dpse\GA29024-PA 277 GA29024-PA 122..276 105..265 212 28.1 Plus
Dpse\GA22633-PA 411 GA22633-PA 130..239 115..229 212 40.9 Plus
Dpse\GA22633-PA 411 GA22633-PA 293..392 145..247 179 38.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:16:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16757-PA 97 GM16757-PA 1..97 173..269 494 90.7 Plus
Dsec\GM16651-PA 249 GM16651-PA 22..249 23..267 332 32.7 Plus
Dsec\GM16582-PA 268 GM16582-PA 55..261 34..265 310 34.3 Plus
Dsec\GM16433-PA 283 GM16433-PA 1..278 1..265 296 32.4 Plus
Dsec\GM18119-PA 291 GM18119-PA 40..288 36..266 280 27.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:16:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23039-PA 269 GD23039-PA 1..269 1..269 1352 92.2 Plus
Dsim\GD23040-PA 783 GD23040-PA 1..267 1..269 405 33.8 Plus
Dsim\GD22945-PA 257 GD22945-PA 33..257 26..267 319 32.7 Plus
Dsim\GD11996-PA 252 GD11996-PA 39..245 34..265 301 33.5 Plus
Dsim\GD22877-PA 230 GD22877-PA 16..227 36..265 286 33.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:16:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16497-PA 252 GJ16497-PA 23..247 37..265 276 30.5 Plus
Dvir\GJ16447-PA 189 GJ16447-PA 35..185 113..265 253 35.4 Plus
Dvir\GJ11333-PA 226 GJ11333-PA 95..226 143..267 227 34.8 Plus
Dvir\GJ18255-PA 159 GJ18255-PA 36..157 145..265 195 32.5 Plus
Dvir\GJ16416-PA 164 GJ16416-PA 46..160 147..265 189 34.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:16:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24541-PA 431 GK24541-PA 35..210 36..247 262 29.6 Plus
Dwil\GK19210-PA 164 GK19210-PA 39..164 143..268 243 35.7 Plus
Dwil\GK19037-PA 249 GK19037-PA 64..239 90..265 206 29.8 Plus
Dwil\GK18670-PA 255 GK18670-PA 134..252 145..268 179 33.3 Plus
Dwil\GK19388-PA 92 GK19388-PA 1..91 173..266 169 37.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:16:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16979-PA 269 GE16979-PA 1..267 1..267 1064 77.9 Plus
Dyak\GE15974-PA 249 GE15974-PA 1..249 1..267 337 31.9 Plus
Dyak\GE15323-PA 368 GE15323-PA 124..361 8..265 297 31.8 Plus
Dyak\GE14533-PA 282 GE14533-PA 45..277 36..265 281 32.1 Plus
Dyak\GE10673-PA 153 GE10673-PA 1..152 112..265 235 31.9 Plus

IP21085.hyp Sequence

Translation from 27 to 836

> IP21085.hyp
MFQHANFFLHVFMACGLYGIRAKDVCPRMSTDKEVCLVELAPVLKYISNN
HKSHWNSANEVQVNETRKQLAKIEGQEKETNDKIKVIHDNVDNEFNALSA
KIKNVKNIQRHLASLELQLQETKKALNLSVEAKKVMPKTEIPSQFQKIGW
RHFFIEKKHKVDWFKATSMCHKMGAHLLTIQSEDELDAIRTELKDINDGS
HDFWLDINDIAKWGEFISLATGMNPPFLKWHKHRPQVQIHQRCVHLRGGE
MMDGKCSEQFLFICQLAVN*

IP21085.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:16:23
Subject Length Description Subject Range Query Range Score Percent Strand
lectin-21Ca-PA 269 CG2826-PA 1..269 1..269 1441 100 Plus
CG2839-PA 826 CG2839-PA 1..267 1..269 392 32.7 Plus
lectin-21Cb-PB 249 CG13686-PB 1..247 1..265 338 32 Plus
CG15358-PC 229 CG15358-PC 16..222 34..265 295 36.1 Plus
CG15358-PB 229 CG15358-PB 16..222 34..265 295 36.1 Plus