IP21094.complete Sequence
375 bp assembled on 2008-05-14
GenBank Submission: BT032957
> IP21094.complete
CAAGTAAAATTCCCGACTCGTTGAAAACATCAGTTGTCATGGTGCAGATG
ATATTCCTGTTTGCTATCCTTGCTGTAATGACCATTGTCCTAATGGAGGC
CAACACTGTTTTGGCACGTGATTGCCTATCTGGAACTTTCGGAGGTCCTT
GCTGGGCCTGGAGTGGAGAAAAGTGCCGCCGTCTCTGCATTGAGGAGGGA
CATGTCAGTGGACACTGCAGTGGCGCAATGAAGTGCTGGTGCGAAGGATG
CTAGATCCACTGCAGTTCAAAAGTGCATGCTGTTTTTTTGTTTATTCTGA
GCCAATAATAAATATACTGTACACCGCACAGTAAAAGGCACGTAAGCATT
GCCTTTCAGGAAAAAAAAAAAAAAA
IP21094.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 16:57:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
dro3-RA | 361 | dro3-RA | 1..361 | 1..361 | 1805 | 100 | Plus |
dro4-RA | 309 | dro4-RA | 20..214 | 58..252 | 450 | 82 | Plus |
dro2-RA | 334 | dro2-RA | 158..244 | 173..259 | 210 | 82.7 | Plus |
dro2-RA | 334 | dro2-RA | 3..76 | 15..88 | 145 | 79.7 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:29:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 3314405..3314761 | 1..360 | 1615 | 97.2 | Plus |
chr3L | 24539361 | chr3L | 3315062..3315256 | 58..252 | 435 | 81.5 | Plus |
chr3L | 24539361 | chr3L | 3313914..3314000 | 173..259 | 210 | 82.8 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:44:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:29:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 3314996..3315356 | 1..361 | 1805 | 100 | Plus |
3L | 28110227 | 3L | 3315656..3315850 | 58..252 | 450 | 82.1 | Plus |
3L | 28110227 | 3L | 3314506..3314592 | 173..259 | 210 | 82.8 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:53:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 3314996..3315356 | 1..361 | 1805 | 100 | Plus |
3L | 28103327 | 3L | 3315656..3315850 | 58..252 | 450 | 82 | Plus |
3L | 28103327 | 3L | 3314506..3314592 | 173..259 | 210 | 82.7 | Plus |
3L | 28103327 | 3L | 3314337..3314424 | 1..88 | 170 | 79.5 | Plus |
Blast to na_te.dros performed on 2019-03-16 06:29:07 has no hits.
IP21094.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:29:55 Download gff for
IP21094.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 3314405..3314761 | 1..360 | 97 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:23:36 Download gff for
IP21094.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
dro3-RA | 1..216 | 39..254 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:50:43 Download gff for
IP21094.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
dro3-RA | 1..216 | 39..254 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:32:42 Download gff for
IP21094.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Drsl3-RA | 1..216 | 39..254 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:49:59 Download gff for
IP21094.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
dro3-RA | 1..216 | 39..254 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:17:34 Download gff for
IP21094.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Drsl3-RA | 1..216 | 39..254 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:13:30 Download gff for
IP21094.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
dro3-RA | 1..360 | 1..360 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:50:43 Download gff for
IP21094.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
dro3-RA | 1..360 | 1..360 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:32:42 Download gff for
IP21094.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Drsl3-RA | 1..360 | 1..360 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:49:59 Download gff for
IP21094.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
dro3-RA | 1..216 | 39..254 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:17:34 Download gff for
IP21094.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Drsl3-RA | 1..360 | 1..360 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:29:55 Download gff for
IP21094.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3314996..3315355 | 1..360 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:29:55 Download gff for
IP21094.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3314996..3315355 | 1..360 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:29:55 Download gff for
IP21094.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3314996..3315355 | 1..360 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:32:42 Download gff for
IP21094.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 3314996..3315355 | 1..360 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:29:10 Download gff for
IP21094.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3314996..3315355 | 1..360 | 100 | | Plus |
IP21094.pep Sequence
Translation from 2 to 253
> IP21094.pep
SKIPDSLKTSVVMVQMIFLFAILAVMTIVLMEANTVLARDCLSGTFGGPC
WAWSGEKCRRLCIEEGHVSGHCSGAMKCWCEGC*
IP21094.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:16:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF24279-PA | 69 | GF24279-PA | 1..69 | 14..83 | 213 | 57.1 | Plus |
Dana\GF10208-PA | 69 | GF10208-PA | 1..69 | 14..83 | 211 | 55.7 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:16:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG15127-PA | 71 | GG15127-PA | 1..71 | 13..83 | 297 | 76.1 | Plus |
Dere\GG15128-PA | 71 | GG15128-PA | 1..71 | 13..83 | 271 | 70.4 | Plus |
Dere\GG15126-PA | 70 | GG15126-PA | 1..70 | 13..83 | 220 | 59.2 | Plus |
Dere\GG15135-PA | 70 | GG15135-PA | 1..70 | 13..83 | 214 | 54.9 | Plus |
Dere\GG15129-PA | 69 | GG15129-PA | 1..69 | 14..83 | 212 | 57.1 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:20:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Drsl3-PA | 71 | CG32283-PA | 1..71 | 13..83 | 401 | 100 | Plus |
Drsl4-PA | 71 | CG32282-PA | 1..71 | 13..83 | 280 | 69 | Plus |
Drsl2-PA | 70 | CG32279-PA | 1..70 | 13..83 | 260 | 64.8 | Plus |
Drsl5-PA | 69 | CG10812-PA | 1..69 | 14..83 | 231 | 58.6 | Plus |
Drs-PA | 70 | CG10810-PA | 1..70 | 13..83 | 230 | 56.3 | Plus |
Drsl6-PA | 72 | CG32268-PA | 1..72 | 13..83 | 211 | 53.4 | Plus |
Drsl1-PA | 69 | CG32274-PA | 1..69 | 14..83 | 180 | 45.7 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:16:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM14561-PA | 71 | GM14561-PA | 1..71 | 13..83 | 323 | 88.7 | Plus |
Dsec\GM14560-PA | 70 | GM14560-PA | 1..70 | 13..83 | 244 | 64.8 | Plus |
Dsec\GM14562-PA | 69 | GM14562-PA | 1..69 | 14..83 | 215 | 57.1 | Plus |
Dsec\GM14569-PA | 72 | GM14569-PA | 1..70 | 13..83 | 214 | 56.3 | Plus |
Dsec\GM14055-PA | 69 | GM14055-PA | 1..69 | 14..83 | 163 | 45.7 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:16:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\dro3-PA | 71 | GD13752-PA | 1..71 | 13..83 | 343 | 91.5 | Plus |
Dsim\dro4-PA | 71 | GD13753-PA | 1..71 | 13..83 | 260 | 69 | Plus |
Dsim\Drs-PA | 70 | GD13760-PA | 1..70 | 13..83 | 217 | 56.3 | Plus |
Dsim\dro5-PA | 69 | GD13754-PA | 1..69 | 14..83 | 215 | 58.6 | Plus |
Dsim\dro1-PA | 69 | GD13331-PA | 1..69 | 14..83 | 176 | 48.6 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:16:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE21353-PA | 71 | GE21353-PA | 1..71 | 13..83 | 274 | 70.4 | Plus |
Dyak\GE21352-PA | 70 | GE21352-PA | 1..70 | 13..83 | 231 | 62 | Plus |
Dyak\GE21361-PA | 70 | GE21361-PA | 1..70 | 13..83 | 217 | 56.3 | Plus |
Dyak\GE21355-PA | 69 | GE21355-PA | 1..69 | 14..83 | 207 | 55.7 | Plus |
Dyak\GE20689-PA | 69 | GE20689-PA | 1..69 | 14..83 | 193 | 51.4 | Plus |
IP21094.hyp Sequence
Translation from 2 to 253
> IP21094.hyp
SKIPDSLKTSVVMVQMIFLFAILAVMTIVLMEANTVLARDCLSGTFGGPC
WAWSGEKCRRLCIEEGHVSGHCSGAMKCWCEGC*
IP21094.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:16:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Drsl3-PA | 71 | CG32283-PA | 1..71 | 13..83 | 401 | 100 | Plus |
Drsl4-PA | 71 | CG32282-PA | 1..71 | 13..83 | 280 | 69 | Plus |
Drsl2-PA | 70 | CG32279-PA | 1..70 | 13..83 | 260 | 64.8 | Plus |
Drsl5-PA | 69 | CG10812-PA | 1..69 | 14..83 | 231 | 58.6 | Plus |
Drs-PA | 70 | CG10810-PA | 1..70 | 13..83 | 230 | 56.3 | Plus |