Clone IP21094 Report

Search the DGRC for IP21094

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:210
Well:94
Vector:pOT2
Associated Gene/TranscriptDrsl3-RA
Protein status:IP21094.pep: gold
Sequenced Size:375

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
dro3 2008-05-05 Release 5.5 slip selected
dro3 2008-08-15 Release 5.9 accounting
dro3 2008-12-18 5.12 accounting

Clone Sequence Records

IP21094.complete Sequence

375 bp assembled on 2008-05-14

GenBank Submission: BT032957

> IP21094.complete
CAAGTAAAATTCCCGACTCGTTGAAAACATCAGTTGTCATGGTGCAGATG
ATATTCCTGTTTGCTATCCTTGCTGTAATGACCATTGTCCTAATGGAGGC
CAACACTGTTTTGGCACGTGATTGCCTATCTGGAACTTTCGGAGGTCCTT
GCTGGGCCTGGAGTGGAGAAAAGTGCCGCCGTCTCTGCATTGAGGAGGGA
CATGTCAGTGGACACTGCAGTGGCGCAATGAAGTGCTGGTGCGAAGGATG
CTAGATCCACTGCAGTTCAAAAGTGCATGCTGTTTTTTTGTTTATTCTGA
GCCAATAATAAATATACTGTACACCGCACAGTAAAAGGCACGTAAGCATT
GCCTTTCAGGAAAAAAAAAAAAAAA

IP21094.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:57:33
Subject Length Description Subject Range Query Range Score Percent Strand
dro3-RA 361 dro3-RA 1..361 1..361 1805 100 Plus
dro4-RA 309 dro4-RA 20..214 58..252 450 82 Plus
dro2-RA 334 dro2-RA 158..244 173..259 210 82.7 Plus
dro2-RA 334 dro2-RA 3..76 15..88 145 79.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:29:08
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 3314405..3314761 1..360 1615 97.2 Plus
chr3L 24539361 chr3L 3315062..3315256 58..252 435 81.5 Plus
chr3L 24539361 chr3L 3313914..3314000 173..259 210 82.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:44:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:29:06
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3314996..3315356 1..361 1805 100 Plus
3L 28110227 3L 3315656..3315850 58..252 450 82.1 Plus
3L 28110227 3L 3314506..3314592 173..259 210 82.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:53:51
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 3314996..3315356 1..361 1805 100 Plus
3L 28103327 3L 3315656..3315850 58..252 450 82 Plus
3L 28103327 3L 3314506..3314592 173..259 210 82.7 Plus
3L 28103327 3L 3314337..3314424 1..88 170 79.5 Plus
Blast to na_te.dros performed on 2019-03-16 06:29:07 has no hits.

IP21094.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:29:55 Download gff for IP21094.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 3314405..3314761 1..360 97   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:23:36 Download gff for IP21094.complete
Subject Subject Range Query Range Percent Splice Strand
dro3-RA 1..216 39..254 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:50:43 Download gff for IP21094.complete
Subject Subject Range Query Range Percent Splice Strand
dro3-RA 1..216 39..254 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:32:42 Download gff for IP21094.complete
Subject Subject Range Query Range Percent Splice Strand
Drsl3-RA 1..216 39..254 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:49:59 Download gff for IP21094.complete
Subject Subject Range Query Range Percent Splice Strand
dro3-RA 1..216 39..254 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:17:34 Download gff for IP21094.complete
Subject Subject Range Query Range Percent Splice Strand
Drsl3-RA 1..216 39..254 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:13:30 Download gff for IP21094.complete
Subject Subject Range Query Range Percent Splice Strand
dro3-RA 1..360 1..360 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:50:43 Download gff for IP21094.complete
Subject Subject Range Query Range Percent Splice Strand
dro3-RA 1..360 1..360 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:32:42 Download gff for IP21094.complete
Subject Subject Range Query Range Percent Splice Strand
Drsl3-RA 1..360 1..360 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:49:59 Download gff for IP21094.complete
Subject Subject Range Query Range Percent Splice Strand
dro3-RA 1..216 39..254 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:17:34 Download gff for IP21094.complete
Subject Subject Range Query Range Percent Splice Strand
Drsl3-RA 1..360 1..360 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:29:55 Download gff for IP21094.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3314996..3315355 1..360 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:29:55 Download gff for IP21094.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3314996..3315355 1..360 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:29:55 Download gff for IP21094.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3314996..3315355 1..360 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:32:42 Download gff for IP21094.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3314996..3315355 1..360 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:29:10 Download gff for IP21094.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3314996..3315355 1..360 100   Plus

IP21094.pep Sequence

Translation from 2 to 253

> IP21094.pep
SKIPDSLKTSVVMVQMIFLFAILAVMTIVLMEANTVLARDCLSGTFGGPC
WAWSGEKCRRLCIEEGHVSGHCSGAMKCWCEGC*

IP21094.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:16:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24279-PA 69 GF24279-PA 1..69 14..83 213 57.1 Plus
Dana\GF10208-PA 69 GF10208-PA 1..69 14..83 211 55.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:16:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15127-PA 71 GG15127-PA 1..71 13..83 297 76.1 Plus
Dere\GG15128-PA 71 GG15128-PA 1..71 13..83 271 70.4 Plus
Dere\GG15126-PA 70 GG15126-PA 1..70 13..83 220 59.2 Plus
Dere\GG15135-PA 70 GG15135-PA 1..70 13..83 214 54.9 Plus
Dere\GG15129-PA 69 GG15129-PA 1..69 14..83 212 57.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:20:01
Subject Length Description Subject Range Query Range Score Percent Strand
Drsl3-PA 71 CG32283-PA 1..71 13..83 401 100 Plus
Drsl4-PA 71 CG32282-PA 1..71 13..83 280 69 Plus
Drsl2-PA 70 CG32279-PA 1..70 13..83 260 64.8 Plus
Drsl5-PA 69 CG10812-PA 1..69 14..83 231 58.6 Plus
Drs-PA 70 CG10810-PA 1..70 13..83 230 56.3 Plus
Drsl6-PA 72 CG32268-PA 1..72 13..83 211 53.4 Plus
Drsl1-PA 69 CG32274-PA 1..69 14..83 180 45.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:16:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14561-PA 71 GM14561-PA 1..71 13..83 323 88.7 Plus
Dsec\GM14560-PA 70 GM14560-PA 1..70 13..83 244 64.8 Plus
Dsec\GM14562-PA 69 GM14562-PA 1..69 14..83 215 57.1 Plus
Dsec\GM14569-PA 72 GM14569-PA 1..70 13..83 214 56.3 Plus
Dsec\GM14055-PA 69 GM14055-PA 1..69 14..83 163 45.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:16:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\dro3-PA 71 GD13752-PA 1..71 13..83 343 91.5 Plus
Dsim\dro4-PA 71 GD13753-PA 1..71 13..83 260 69 Plus
Dsim\Drs-PA 70 GD13760-PA 1..70 13..83 217 56.3 Plus
Dsim\dro5-PA 69 GD13754-PA 1..69 14..83 215 58.6 Plus
Dsim\dro1-PA 69 GD13331-PA 1..69 14..83 176 48.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:16:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21353-PA 71 GE21353-PA 1..71 13..83 274 70.4 Plus
Dyak\GE21352-PA 70 GE21352-PA 1..70 13..83 231 62 Plus
Dyak\GE21361-PA 70 GE21361-PA 1..70 13..83 217 56.3 Plus
Dyak\GE21355-PA 69 GE21355-PA 1..69 14..83 207 55.7 Plus
Dyak\GE20689-PA 69 GE20689-PA 1..69 14..83 193 51.4 Plus

IP21094.hyp Sequence

Translation from 2 to 253

> IP21094.hyp
SKIPDSLKTSVVMVQMIFLFAILAVMTIVLMEANTVLARDCLSGTFGGPC
WAWSGEKCRRLCIEEGHVSGHCSGAMKCWCEGC*

IP21094.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:16:30
Subject Length Description Subject Range Query Range Score Percent Strand
Drsl3-PA 71 CG32283-PA 1..71 13..83 401 100 Plus
Drsl4-PA 71 CG32282-PA 1..71 13..83 280 69 Plus
Drsl2-PA 70 CG32279-PA 1..70 13..83 260 64.8 Plus
Drsl5-PA 69 CG10812-PA 1..69 14..83 231 58.6 Plus
Drs-PA 70 CG10810-PA 1..70 13..83 230 56.3 Plus