Clone IP21117 Report

Search the DGRC for IP21117

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:211
Well:17
Vector:pOT2
Associated Gene/TranscriptCG15210-RA
Protein status:IP21117.pep: gold
Sequenced Size:596

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15210 2008-12-18 5.12 accounting

Clone Sequence Records

IP21117.complete Sequence

596 bp assembled on 2008-12-10

GenBank Submission: BT053717.1

> IP21117.complete
CAGCAACAAGTTACTGGCCCCCGATATACATTAATATAGAACGAAAAATA
AAGGCATTCCGAACCAAACCATTTATACCATATATACAACGAATACGTAT
TTCTATATACGCACAAAACCAAAGAATGGGAGGCTGTTGCTCAAAGGATT
TGGATGACAAACGCTCGTGGAGTCCCGAGGAGACCAAGAATGGCAGCACC
ACATCAACAATCATTGCCCAGCCGCTGGATGAGGTGGGCACCACCGGTGT
CTTCACATTGACACGCACCACCACTAGCACCACGCGGCAGGAGAAGACGG
TGACCACCACCAGCGAGGAGCAGGAGCAGGATTAGCTGCCATCAGATTAA
CTGACGTGAAAAGAACCAAAACCTTTTTTTTTGAAACCATTTCAATGCCA
ATGTGTGCGTGAGTGTGTGCGTGAGTCTGTTGTGAGTGTGTGAATAAATA
ATAAAAAGATAATGTACATACGAACAATGTGAATATGAATATGAATCAAG
TTAAGCTGTTAACGAGTAATTATTAATTGTTATGCGCCTGAATTTCAATA
TCGTAATAAATTGTTGAATCGCTAAATAAAAAAAAAAAAAAAAAAA

IP21117.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:15:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG15210-RA 887 CG15210-RA 228..805 1..578 2890 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:06:16
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 10730812..10731194 195..577 1885 99.5 Plus
chrX 22417052 chrX 10730561..10730754 1..194 970 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:44:31 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:06:14
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 10839513..10839896 195..578 1920 100 Plus
X 23542271 X 10839262..10839455 1..194 970 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:32:45
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 10847611..10847994 195..578 1920 100 Plus
X 23527363 X 10847360..10847553 1..194 970 100 Plus
Blast to na_te.dros performed 2019-03-15 21:06:15
Subject Length Description Subject Range Query Range Score Percent Strand
mdg1 7480 mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). 25..101 447..522 130 64.9 Plus
mdg1 7480 mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). 7063..7139 447..522 130 64.9 Plus
Quasimodo 7387 Quasimodo QUASIMODO 7387bp Derived from P1 clones DS08479 & DS07153 by Sue Celniker, 29 March 2001. 6536..6636 25..126 129 59.8 Plus
Dmir\TRIM 3111 Dmir\TRIM DMTRIM 3126bp Derived from X59239 (Rel. 35, Last updated, Version 3). 2784..2838 176..229 110 69.1 Plus

IP21117.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:07:08 Download gff for IP21117.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 10730561..10730754 1..194 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:04:09 Download gff for IP21117.complete
Subject Subject Range Query Range Percent Splice Strand
CG15210-RA 1..210 126..335 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:22:13 Download gff for IP21117.complete
Subject Subject Range Query Range Percent Splice Strand
CG15210-RA 1..210 126..335 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:38:10 Download gff for IP21117.complete
Subject Subject Range Query Range Percent Splice Strand
CG15210-RA 1..210 126..335 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:44:01 Download gff for IP21117.complete
Subject Subject Range Query Range Percent Splice Strand
CG15210-RA 1..210 126..335 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-12-10 18:16:54 Download gff for IP21117.complete
Subject Subject Range Query Range Percent Splice Strand
CG15210-RA 1..210 126..335 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:22:13 Download gff for IP21117.complete
Subject Subject Range Query Range Percent Splice Strand
CG15210-RA 33..484 1..452 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:38:10 Download gff for IP21117.complete
Subject Subject Range Query Range Percent Splice Strand
CG15210-RA 33..609 1..577 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:44:01 Download gff for IP21117.complete
Subject Subject Range Query Range Percent Splice Strand
CG15210-RA 33..609 1..577 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:07:08 Download gff for IP21117.complete
Subject Subject Range Query Range Percent Splice Strand
X 10839262..10839455 1..194 100 -> Plus
X 10839513..10839895 195..577 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:07:08 Download gff for IP21117.complete
Subject Subject Range Query Range Percent Splice Strand
X 10839262..10839455 1..194 100 -> Plus
X 10839513..10839895 195..577 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:07:08 Download gff for IP21117.complete
Subject Subject Range Query Range Percent Splice Strand
X 10839262..10839455 1..194 100 -> Plus
X 10839513..10839895 195..577 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:38:10 Download gff for IP21117.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 10733295..10733488 1..194 100 -> Plus
arm_X 10733546..10733928 195..577 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:53:57 Download gff for IP21117.complete
Subject Subject Range Query Range Percent Splice Strand
X 10847611..10847993 195..577 100   Plus
X 10847360..10847553 1..194 100 -> Plus

IP21117.pep Sequence

Translation from 2 to 334

> IP21117.pep
ATSYWPPIYINIERKIKAFRTKPFIPYIQRIRISIYAQNQRMGGCCSKDL
DDKRSWSPEETKNGSTTSTIIAQPLDEVGTTGVFTLTRTTTSTTRQEKTV
TTTSEEQEQD*

IP21117.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:27:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20426-PA 67 GF20426-PA 1..43 42..84 227 97.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:27:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18370-PA 69 GG18370-PA 1..69 42..110 339 97.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 11:27:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12654-PA 87 GH12654-PA 1..45 42..86 220 88.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:57:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG15210-PA 69 CG15210-PA 1..69 42..110 359 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:28:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14826-PA 84 GI14826-PA 1..47 42..88 236 91.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:28:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14323-PA 67 GL14323-PA 1..63 42..105 246 84.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:28:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13572-PA 67 GA13572-PA 1..63 42..105 246 84.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:28:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11434-PA 69 GM11434-PA 1..69 42..110 339 97.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:28:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16988-PA 69 GD16988-PA 1..69 42..110 342 98.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:28:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19491-PA 91 GJ19491-PA 1..43 42..84 217 90.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:28:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16451-PA 72 GK16451-PA 1..72 42..109 224 70.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:28:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17859-PA 69 GE17859-PA 1..69 42..110 280 95.7 Plus

IP21117.hyp Sequence

Translation from 2 to 334

> IP21117.hyp
ATSYWPPIYINIERKIKAFRTKPFIPYIQRIRISIYAQNQRMGGCCSKDL
DDKRSWSPEETKNGSTTSTIIAQPLDEVGTTGVFTLTRTTTSTTRQEKTV
TTTSEEQEQD*

IP21117.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:16:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG15210-PA 69 CG15210-PA 1..69 42..110 359 100 Plus