Clone IP21127 Report

Search the DGRC for IP21127

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:211
Well:27
Vector:pOT2
Associated Gene/TranscriptCG34015-RA
Protein status:IP21127.pep: gold
Sequenced Size:571

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34015 2008-05-05 Release 5.5 slip selected
CG34015 2008-08-15 Release 5.9 accounting
CG34015 2008-12-18 5.12 accounting

Clone Sequence Records

IP21127.complete Sequence

571 bp assembled on 2008-05-22

GenBank Submission: BT032784

> IP21127.complete
CTGCTATATTTTATATAGACTGAACTTAAAATTAAGTCATGGCGGACGAC
AACTGCATTTTCTGCCTAATTTCCGATGGGCGGATCCCCTCCACTGTTTT
GGAAGTCGAAAACGATGACTTTGTCATCTTCCAGGACATTAAACCCGCTT
CCCAGCACCATTACTTAGCAGTGACAAAAAAGCACTACGCTAGCCTCAAG
GATCTTAACAAATCGCACGATTCTTTGGTGCAGCTCATGGAGAACGCCCT
GAAGGATCTTCTGGTGTCCAAGGGAGTTTCTGTCGATGATGCCCTCTTCG
GATTCCATCTGCCGCCGTTTATCACGGTGAAGCATCTTCACATGCATGCC
ATTAGCCCACGCACCCAAATGACCTTCCTATCTAAGATGATCTTTAGACC
CTCCGTTTGGTTCAAAACCGTCGACGAGGCGCGTATTTACCTTTCCCAAA
AAGAATAGATCGGGACCATCATAGATAACTGTTAGATAAATATATATTGT
ACTCGCGCGCTGTCATAATTAACTAATAAACGGAGCCAACCTATACAAAT
AAAAAAAAAAAAAAAAAAAAA

IP21127.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:52:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG34015-RA 700 CG34015-RA 92..642 1..551 2755 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:16:13
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 16337746..16337973 228..1 1140 100 Minus
chrX 22417052 chrX 16337485..16337678 421..228 970 100 Minus
chrX 22417052 chrX 16337283..16337413 550..420 625 98.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:44:32 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:16:12
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 16448031..16448258 228..1 1140 100 Minus
X 23542271 X 16447770..16447963 421..228 970 100 Minus
X 23542271 X 16447567..16447698 551..420 660 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:48:43
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 16456129..16456356 228..1 1140 100 Minus
X 23527363 X 16455868..16456061 421..228 970 100 Minus
X 23527363 X 16455665..16455796 551..420 660 100 Minus
Blast to na_te.dros performed 2019-03-16 13:16:12
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy7 5486 gypsy7 GYPSY7 5486bp 3763..3821 492..550 105 68.3 Plus

IP21127.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:16:54 Download gff for IP21127.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 16337283..16337413 420..550 98 <- Minus
chrX 16337487..16337677 229..419 100 <- Minus
chrX 16337746..16337973 1..228 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:23:42 Download gff for IP21127.complete
Subject Subject Range Query Range Percent Splice Strand
CG34015-RA 1..420 39..458 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:38:34 Download gff for IP21127.complete
Subject Subject Range Query Range Percent Splice Strand
CG34015-RA 1..420 39..458 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:26:36 Download gff for IP21127.complete
Subject Subject Range Query Range Percent Splice Strand
CG34015-RA 1..420 39..458 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:44:24 Download gff for IP21127.complete
Subject Subject Range Query Range Percent Splice Strand
CG34015-RA 1..420 39..458 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:16:31 Download gff for IP21127.complete
Subject Subject Range Query Range Percent Splice Strand
CG34015-RA 1..420 39..458 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:07:52 Download gff for IP21127.complete
Subject Subject Range Query Range Percent Splice Strand
CG34015-RA 1..420 39..458 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:38:34 Download gff for IP21127.complete
Subject Subject Range Query Range Percent Splice Strand
CG34015-RA 45..594 1..550 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:26:36 Download gff for IP21127.complete
Subject Subject Range Query Range Percent Splice Strand
CG34015-RA 45..594 1..550 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:44:25 Download gff for IP21127.complete
Subject Subject Range Query Range Percent Splice Strand
CG34015-RA 1..420 39..458 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:16:31 Download gff for IP21127.complete
Subject Subject Range Query Range Percent Splice Strand
CG34015-RA 45..594 1..550 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:16:54 Download gff for IP21127.complete
Subject Subject Range Query Range Percent Splice Strand
X 16447568..16447698 420..550 100 <- Minus
X 16447772..16447962 229..419 100 <- Minus
X 16448031..16448258 1..228 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:16:54 Download gff for IP21127.complete
Subject Subject Range Query Range Percent Splice Strand
X 16447568..16447698 420..550 100 <- Minus
X 16447772..16447962 229..419 100 <- Minus
X 16448031..16448258 1..228 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:16:54 Download gff for IP21127.complete
Subject Subject Range Query Range Percent Splice Strand
X 16447568..16447698 420..550 100 <- Minus
X 16447772..16447962 229..419 100 <- Minus
X 16448031..16448258 1..228 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:26:36 Download gff for IP21127.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 16341601..16341731 420..550 100 <- Minus
arm_X 16341805..16341995 229..419 100 <- Minus
arm_X 16342064..16342291 1..228 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:21:08 Download gff for IP21127.complete
Subject Subject Range Query Range Percent Splice Strand
X 16456129..16456356 1..228 100   Minus
X 16455666..16455796 420..550 100 <- Minus
X 16455870..16456060 229..419 100 <- Minus

IP21127.pep Sequence

Translation from 38 to 457

> IP21127.pep
MADDNCIFCLISDGRIPSTVLEVENDDFVIFQDIKPASQHHYLAVTKKHY
ASLKDLNKSHDSLVQLMENALKDLLVSKGVSVDDALFGFHLPPFITVKHL
HMHAISPRTQMTFLSKMIFRPSVWFKTVDEARIYLSQKE*

IP21127.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:56:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10237-PA 140 GF10237-PA 1..139 1..139 541 71.2 Plus
Dana\GF15313-PA 174 GF15313-PA 38..173 5..139 324 46.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:56:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19320-PA 139 GG19320-PA 1..139 1..139 605 81.3 Plus
Dere\GG24817-PA 168 GG24817-PA 33..167 6..139 340 48.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:56:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17587-PA 140 GH17587-PA 1..138 1..138 455 57.6 Plus
Dgri\GH17102-PA 145 GH17102-PA 1..128 1..128 437 59.7 Plus
Dgri\GH10860-PA 162 GH10860-PA 38..161 6..128 336 49.2 Plus
Dgri\GH25016-PA 174 GH25016-PA 38..160 6..127 332 48.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:48:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG34015-PA 139 CG34015-PA 1..139 1..139 724 100 Plus
CG15362-PA 168 CG15362-PA 31..167 4..139 330 47.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:56:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11708-PA 140 GI11708-PA 1..138 1..138 461 61.2 Plus
Dmoj\GI13693-PA 163 GI13693-PA 38..163 6..130 350 50 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:56:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20536-PA 152 GL20536-PA 13..151 2..139 338 45.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:56:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25735-PA 140 GA25735-PA 1..139 1..139 518 66.2 Plus
Dpse\GA13672-PA 181 GA13672-PA 42..180 2..139 338 45.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:56:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13398-PA 139 GM13398-PA 1..139 1..139 654 89.2 Plus
Dsec\GM16839-PA 168 GM16839-PA 31..167 4..139 349 48.2 Plus
Dsec\GM10095-PA 168 GM10095-PA 31..167 4..139 349 48.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:56:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15748-PA 139 GD15748-PA 1..139 1..139 657 89.9 Plus
Dsim\GD23121-PA 168 GD23121-PA 31..167 4..139 347 48.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:56:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11382-PA 140 GJ11382-PA 1..138 1..138 475 59.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:56:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10717-PA 140 GK10717-PA 5..138 6..138 463 61.9 Plus
Dwil\GK24814-PA 161 GK24814-PA 25..160 6..139 339 48.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:56:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15967-PA 139 GE15967-PA 1..139 1..139 632 81.3 Plus
Dyak\GE17812-PA 168 GE17812-PA 30..167 3..139 351 48.6 Plus

IP21127.hyp Sequence

Translation from 38 to 457

> IP21127.hyp
MADDNCIFCLISDGRIPSTVLEVENDDFVIFQDIKPASQHHYLAVTKKHY
ASLKDLNKSHDSLVQLMENALKDLLVSKGVSVDDALFGFHLPPFITVKHL
HMHAISPRTQMTFLSKMIFRPSVWFKTVDEARIYLSQKE*

IP21127.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:16:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG34015-PA 139 CG34015-PA 1..139 1..139 724 100 Plus
CG15362-PA 168 CG15362-PA 31..167 4..139 330 47.4 Plus