Clone IP21134 Report

Search the DGRC for IP21134

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:211
Well:34
Vector:pOT2
Associated Gene/TranscriptCcp84Af-RA
Protein status:IP21134.pep: gold
Sequenced Size:580

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Ccp84Af 2008-05-05 Release 5.5 slip selected
Ccp84Af 2008-08-15 Release 5.9 accounting
Ccp84Af 2008-12-18 5.12 accounting

Clone Sequence Records

IP21134.complete Sequence

580 bp assembled on 2008-05-14

GenBank Submission: BT032959

> IP21134.complete
ATAACCACCACCAGCCCTCCTCCAAGTCCAGAGCCATGGCCTTCAAGTTC
TTCGCTGTTCTCGCCCTCATCTCGGCCGCCAGTGCCGGAGTTCTTCCCGT
CCAGCAGGTGTATCACGCCGCCCCCGCCGTGGCCACCTACGCCCAAGCAC
CTGTCGCCGTTGCCCACGCCCAGCCGGTTCTGACCAAGGCCACCGAGGAA
TACGATCCCCATCCCCAGTACAAGTTCGCCTACGATGTCCAGGACTCCCT
TTCCGGAGACTCGAAGAGTCAGGTTGAGGAGCGTGATGGCGACGTGGTCC
ATGGCGAGTACTCCCTGATCGATTCCGATGGCTACAAGCGCATTGTCCAG
TACACCTCCGACCCGGTCAACGGTTTCAACGCCGTCGTCAACCGCGTTCC
CCTGGATCACGTGAAGACCGTGGTGAAGACCGTGGCTCCTGTGGCCGTGG
CTGCTGCCCCTATCCCAGTGGCCTACCACCAGCACCACTGAGGAACTCTC
CTACTGATTTGTTGAATCCGTTTGTAGATCAAATAAATTGTTGAATATTT
GTAAGCTGAAAGAAAAAAAAAAAAAAAAAA

IP21134.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:57:17
Subject Length Description Subject Range Query Range Score Percent Strand
Ccp84Af-RA 680 Ccp84Af-RA 119..680 1..562 2810 100 Plus
Ccp84Ad-RA 862 Ccp84Ad-RA 189..558 36..405 1205 88.3 Plus
Cpr5C-RA 643 Cpr5C-RA 230..502 167..445 605 81.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:18:12
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 2515396..2515912 562..46 2585 100 Minus
chr3R 27901430 chr3R 2518678..2519022 61..405 1185 89.6 Plus
chrX 22417052 chrX 5697339..5697611 167..445 595 81.7 Plus
chr3R 27901430 chr3R 2530068..2530362 105..405 465 77.7 Plus
chr3R 27901430 chr3R 2528165..2528459 405..105 420 76.7 Minus
chr3R 27901430 chr3R 2512900..2513087 195..382 340 78.7 Plus
chr3R 27901430 chr3R 2517059..2517244 389..204 315 78 Minus
chr3R 27901430 chr3R 2521531..2521726 405..210 275 76 Minus
chr3L 24539361 chr3L 4215331..4215509 204..382 250 76 Plus
chr3R 27901430 chr3R 2515969..2516015 47..1 235 100 Minus
chr2L 23010047 chr2L 11943822..11943987 190..355 215 75.3 Plus
chr3L 24539361 chr3L 4210466..4210641 379..204 205 74.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:44:34 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:18:11
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 6689599..6690118 565..46 2600 100 Minus
3R 32079331 3R 6692884..6693228 61..405 1170 89.3 Plus
X 23542271 X 5804931..5805203 167..445 595 81.7 Plus
3R 32079331 3R 6704277..6704571 105..405 465 77.7 Plus
3R 32079331 3R 6702374..6702668 405..105 420 76.7 Minus
3R 32079331 3R 6687088..6687275 195..382 340 78.7 Plus
3R 32079331 3R 6691265..6691450 389..204 315 78 Minus
3R 32079331 3R 6695740..6695935 405..210 275 76 Minus
3L 28110227 3L 4215945..4216123 204..382 250 76 Plus
3R 32079331 3R 6690175..6690221 47..1 235 100 Minus
2L 23513712 2L 11945176..11945341 190..355 215 75.3 Plus
3L 28110227 3L 4211080..4211255 379..204 205 74.4 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:53:06
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 6430430..6430949 565..46 2600 100 Minus
3R 31820162 3R 6433715..6434059 61..405 1170 89.2 Plus
X 23527363 X 5813029..5813258 167..396 550 82.6 Plus
3R 31820162 3R 6445108..6445402 105..405 475 77.7 Plus
3R 31820162 3R 6443205..6443499 405..105 430 76.7 Minus
3R 31820162 3R 6427919..6428106 195..382 340 78.7 Plus
3R 31820162 3R 6432143..6432281 342..204 290 80.5 Minus
3R 31820162 3R 6436571..6436766 405..210 275 76 Minus
3L 28103327 3L 4215945..4216123 204..382 250 75.9 Plus
3R 31820162 3R 6431006..6431052 47..1 235 100 Minus
X 23527363 X 5813267..5813301 411..445 145 94.2 Plus
Blast to na_te.dros performed on 2019-03-16 01:18:11 has no hits.

IP21134.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:18:52 Download gff for IP21134.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 2515396..2515910 48..562 95 <- Minus
chr3R 2515969..2516015 1..47 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:23:44 Download gff for IP21134.complete
Subject Subject Range Query Range Percent Splice Strand
Ccp84Af-RA 1..456 36..491 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:48:41 Download gff for IP21134.complete
Subject Subject Range Query Range Percent Splice Strand
Ccp84Af-RA 1..456 36..491 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:04:54 Download gff for IP21134.complete
Subject Subject Range Query Range Percent Splice Strand
Ccp84Af-RA 1..456 36..491 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:49:22 Download gff for IP21134.complete
Subject Subject Range Query Range Percent Splice Strand
Ccp84Af-RA 1..456 36..491 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:30:57 Download gff for IP21134.complete
Subject Subject Range Query Range Percent Splice Strand
Ccp84Af-RA 1..456 36..491 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:12:55 Download gff for IP21134.complete
Subject Subject Range Query Range Percent Splice Strand
Ccp84Af-RA 1..456 36..491 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:48:41 Download gff for IP21134.complete
Subject Subject Range Query Range Percent Splice Strand
Ccp84Af-RA 19..580 1..562 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:04:54 Download gff for IP21134.complete
Subject Subject Range Query Range Percent Splice Strand
Ccp84Af-RA 19..580 1..562 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:49:22 Download gff for IP21134.complete
Subject Subject Range Query Range Percent Splice Strand
Ccp84Af-RA 1..456 36..491 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:30:57 Download gff for IP21134.complete
Subject Subject Range Query Range Percent Splice Strand
Ccp84Af-RA 19..580 1..562 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:18:52 Download gff for IP21134.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6689602..6690116 48..562 100 <- Minus
3R 6690175..6690221 1..47 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:18:52 Download gff for IP21134.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6689602..6690116 48..562 100 <- Minus
3R 6690175..6690221 1..47 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:18:52 Download gff for IP21134.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6689602..6690116 48..562 100 <- Minus
3R 6690175..6690221 1..47 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:04:54 Download gff for IP21134.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2515324..2515838 48..562 100 <- Minus
arm_3R 2515897..2515943 1..47 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:27:57 Download gff for IP21134.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6430433..6430947 48..562 100 <- Minus
3R 6431006..6431052 1..47 100   Minus

IP21134.pep Sequence

Translation from 2 to 490

> IP21134.pep
NHHQPSSKSRAMAFKFFAVLALISAASAGVLPVQQVYHAAPAVATYAQAP
VAVAHAQPVLTKATEEYDPHPQYKFAYDVQDSLSGDSKSQVEERDGDVVH
GEYSLIDSDGYKRIVQYTSDPVNGFNAVVNRVPLDHVKTVVKTVAPVAVA
AAPIPVAYHQHH*

IP21134.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:09:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17802-PA 153 GF17802-PA 1..153 12..162 502 87 Plus
Dana\GF21210-PA 141 GF21210-PA 1..141 12..159 428 67.3 Plus
Dana\GF17186-PA 221 GF17186-PA 1..176 12..153 419 65 Plus
Dana\GF17800-PA 223 GF17800-PA 1..145 12..155 359 55.3 Plus
Dana\GF17187-PA 217 GF17187-PA 1..165 12..153 351 54.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:09:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10313-PA 151 GG10313-PA 1..151 12..162 747 96.7 Plus
Dere\GG13631-PA 199 GG13631-PA 1..123 12..134 480 88.6 Plus
Dere\GG18788-PA 145 GG18788-PA 1..144 12..159 428 71.3 Plus
Dere\GG10280-PA 230 GG10280-PA 1..123 12..134 408 71.2 Plus
Dere\GG13642-PA 220 GG13642-PA 1..123 12..134 406 71.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:09:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19489-PA 147 GH19489-PA 1..147 12..162 579 80.3 Plus
Dgri\GH18128-PA 166 GH18128-PA 1..166 12..159 487 66.9 Plus
Dgri\GH19487-PA 201 GH19487-PA 1..176 12..155 425 64.2 Plus
Dgri\GH19485-PA 227 GH19485-PA 1..150 12..153 410 63.9 Plus
Dgri\GH18129-PA 227 GH18129-PA 1..150 12..153 407 63.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:20:19
Subject Length Description Subject Range Query Range Score Percent Strand
Ccp84Af-PA 151 CG1331-PA 1..151 12..162 775 100 Plus
Ccp84Ad-PA 199 CG2341-PA 1..151 12..158 598 82.1 Plus
Cpr5C-PA 145 CG4052-PA 1..144 12..159 542 74.7 Plus
Ccp84Aa-PA 205 CG2360-PA 1..151 12..158 491 69.3 Plus
Ccp84Ab-PA 221 CG1252-PA 1..151 12..158 486 68.6 Plus
Ccp84Ag-PA 191 CG2342-PA 1..121 12..156 345 52.7 Plus
Ccp84Ac-PA 217 CG1327-PA 1..149 12..157 341 51 Plus
Ccp84Ae-PA 208 CG1330-PA 1..138 12..157 338 52.6 Plus
Cpr64Ad-PB 247 CG1259-PB 86..236 13..156 313 52.9 Plus
Cpr64Aa-PA 192 CG15006-PA 1..140 12..158 305 50 Plus
Edg84A-PA 188 CG2345-PA 12..114 51..153 279 54.7 Plus
Cpr31A-PA 340 CG33302-PA 96..218 39..159 271 48.8 Plus
Cpr64Ab-PA 120 CG15007-PA 25..118 56..154 269 58.6 Plus
Cpr92A-PA 245 CG6240-PA 58..152 63..158 257 54.2 Plus
Crys-PB 477 CG16963-PB 60..139 56..135 251 57.5 Plus
Crys-PA 477 CG16963-PA 60..139 56..135 251 57.5 Plus
Cpr62Bc-PB 180 CG1919-PB 4..146 14..162 245 44.2 Plus
Cpr62Bc-PA 180 CG1919-PA 4..146 14..162 245 44.2 Plus
Cpr30F-PA 146 CG31876-PA 2..129 17..158 241 43.9 Plus
CG34461-PB 138 CG34461-PB 2..137 15..162 239 41.1 Plus
CG34461-PA 138 CG34461-PA 2..137 15..162 239 41.1 Plus
Cpr64Ac-PA 188 CG15008-PA 44..166 23..157 232 45.3 Plus
Cpr23B-PA 302 CG2973-PA 150..235 66..155 218 54.4 Plus
Cpr62Bb-PC 194 CG13935-PC 16..146 49..159 207 44.1 Plus
Cpr62Bb-PB 194 CG13935-PB 16..146 49..159 207 44.1 Plus
Cpr62Bb-PA 194 CG13935-PA 16..146 49..159 207 44.1 Plus
Cpr76Bd-PD 1228 CG9299-PD 1116..1209 38..129 201 46.8 Plus
Cpr76Bd-PB 1228 CG9299-PB 1116..1209 38..129 201 46.8 Plus
Cpr76Bd-PC 1231 CG9299-PC 1119..1212 38..129 201 46.8 Plus
CG42367-PC 103 CG42367-PC 3..100 36..134 198 45 Plus
Cpr76Bb-PA 198 CG9290-PA 76..149 65..136 198 52.7 Plus
Cpr30B-PA 153 CG3818-PA 23..128 62..153 188 43.9 Plus
Cpr66Cb-PA 162 CG7076-PA 64..153 55..136 186 47.8 Plus
Cpr35B-PA 218 CG3474-PA 1..136 12..136 186 36.4 Plus
Cpr76Ba-PA 204 CG9283-PA 77..159 49..132 181 48.8 Plus
Cpr66D-PA 270 CG32029-PA 120..237 33..152 174 34.7 Plus
Cpr76Bc-PD 424 CG9295-PD 44..115 64..132 172 51.4 Plus
Cpr76Bc-PC 424 CG9295-PC 44..115 64..132 172 51.4 Plus
CG13670-PA 266 CG13670-PA 81..159 51..129 158 41.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:09:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23757-PA 176 GI23757-PA 1..168 12..159 453 65.7 Plus
Dmoj\GI23842-PA 176 GI23842-PA 1..168 12..159 452 65.7 Plus
Dmoj\GI23759-PA 145 GI23759-PA 1..144 12..159 436 73.2 Plus
Dmoj\GI23843-PA 227 GI23843-PA 1..113 12..134 395 66.7 Plus
Dmoj\GI23755-PA 191 GI23755-PA 1..150 12..159 371 58.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:09:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22052-PA 151 GL22052-PA 1..151 12..162 537 88.8 Plus
Dper\GL21770-PA 213 GL21770-PA 1..132 12..143 514 81.8 Plus
Dper\GL22048-PA 315 GL22048-PA 1..123 12..136 410 68.8 Plus
Dper\GL21772-PA 223 GL21772-PA 4..102 35..134 354 71 Plus
Dper\GL22049-PA 231 GL22049-PA 1..149 12..159 322 49.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:09:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27360-PA 151 GA27360-PA 1..151 12..162 537 88.8 Plus
Dpse\GA26395-PA 213 GA26395-PA 1..132 12..143 474 82.6 Plus
Dpse\GA27359-PA 211 GA27359-PA 1..130 12..143 446 70.5 Plus
Dpse\GA26397-PA 242 GA26397-PA 1..121 12..134 403 68.3 Plus
Dpse\GA12160-PA 231 GA12160-PA 1..149 12..159 324 49.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:09:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10535-PA 151 GM10535-PA 1..151 12..162 750 97.4 Plus
Dsec\GM10911-PA 199 GM10911-PA 1..123 12..134 480 88.6 Plus
Dsec\GM12439-PA 145 GM12439-PA 1..144 12..159 443 74 Plus
Dsec\GM10531-PA 236 GM10531-PA 1..123 12..134 408 71.2 Plus
Dsec\GM10912-PA 211 GM10912-PA 1..123 12..134 406 71.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:09:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19531-PA 151 GD19531-PA 1..151 12..162 750 97.4 Plus
Dsim\GD16755-PA 145 GD16755-PA 1..144 12..159 469 74 Plus
Dsim\GD19526-PA 236 GD19526-PA 1..141 12..148 424 67.8 Plus
Dsim\GD19891-PA 193 GD19891-PA 1..135 12..148 397 74.8 Plus
Dsim\GD19528-PA 217 GD19528-PA 1..139 12..147 329 52.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:09:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23943-PA 155 GJ23943-PA 1..155 12..162 495 72.9 Plus
Dvir\GJ23301-PA 175 GJ23301-PA 1..147 12..158 409 70.3 Plus
Dvir\GJ23940-PA 200 GJ23940-PA 1..127 12..134 399 75.6 Plus
Dvir\GJ23938-PA 233 GJ23938-PA 1..162 12..159 399 59.8 Plus
Dvir\GJ23302-PA 256 GJ23302-PA 1..118 12..134 390 68.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:09:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10834-PA 219 GK10834-PA 1..132 12..134 403 73.5 Plus
Dwil\GK12248-PA 219 GK12248-PA 1..132 12..134 403 73.5 Plus
Dwil\GK12249-PA 228 GK12249-PA 1..132 12..153 387 61.3 Plus
Dwil\GK10832-PA 179 GK10832-PA 1..132 12..153 386 61.3 Plus
Dwil\GK10833-PA 220 GK10833-PA 1..188 12..161 316 46.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:09:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25838-PA 151 GE25838-PA 1..151 12..162 591 94 Plus
Dyak\GE24880-PA 181 GE24880-PA 1..123 12..134 481 88.6 Plus
Dyak\GE16433-PA 154 GE16433-PA 1..138 12..143 458 76.6 Plus
Dyak\GE25835-PA 212 GE25835-PA 1..115 12..134 412 67.2 Plus
Dyak\GE24881-PA 228 GE24881-PA 1..123 12..134 405 71.2 Plus

IP21134.hyp Sequence

Translation from 2 to 490

> IP21134.hyp
NHHQPSSKSRAMAFKFFAVLALISAASAGVLPVQQVYHAAPAVATYAQAP
VAVAHAQPVLTKATEEYDPHPQYKFAYDVQDSLSGDSKSQVEERDGDVVH
GEYSLIDSDGYKRIVQYTSDPVNGFNAVVNRVPLDHVKTVVKTVAPVAVA
AAPIPVAYHQHH*

IP21134.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:16:58
Subject Length Description Subject Range Query Range Score Percent Strand
Ccp84Af-PA 151 CG1331-PA 1..151 12..162 775 100 Plus
Ccp84Ad-PA 199 CG2341-PA 1..151 12..158 598 82.1 Plus
Cpr5C-PA 145 CG4052-PA 1..144 12..159 542 74.7 Plus
Ccp84Aa-PA 205 CG2360-PA 1..151 12..158 491 69.3 Plus
Ccp84Ab-PA 221 CG1252-PA 1..151 12..158 486 68.6 Plus