Clone IP21136 Report

Search the DGRC for IP21136

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:211
Well:36
Vector:pOT2
Associated Gene/TranscriptCheA84a-RA
Protein status:IP21136.pep: gold
Sequenced Size:613

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG33779 2008-05-05 Release 5.5 slip selected
CG33779 2008-08-15 Release 5.9 accounting
CG33779 2008-12-18 5.12 accounting

Clone Sequence Records

IP21136.complete Sequence

613 bp assembled on 2008-05-14

GenBank Submission: BT032960

> IP21136.complete
GTAAAACAATGAAGCAGTTTCTATTTTGTGTACTAATAATGCTGATCGGC
AAAACTTGCGCATTGATTCCGAGAACCTATGAAACGCGTTTCATTTCGAT
TACCTCAAATGGCACCAACTTGTTCGATTTCAGCCAAATTAGGTTTTTGG
GCCGAGAACGCATGGCAAATGGCACTTTCGAATTGAAGGAGGATCTGGAT
AATGAATCATTTTCAGTCGTCGGTGAAACTTTCATCGATTCTGTGGGCGA
TGGCGAGTATAAGCAGCTTCCGTTTACCGCTCCCAAACAATCCGTCTGCA
CGGCATTGAAGGCCTATTGGTCGTACTTTGAGCCGAGTATAAAGTACGGA
GTTAAGACGGACTTTCCCGCTCATACCCATCCATGTCCCCTACCAAAGGG
AATATACTATATAAAGGATGTAGTTCTCAAAAACGACAATTGGCCAGTCA
TAATGCCGCGAGGTTATCTAAAGGCCGTGGCCAATCTTTTCAAAAATGAC
GAATATGGCGGCAGTCTAGAAATTGTTTCACAAATTAGCGACTTGTCTTA
GCCAAGAAATAAACGACAAAATGTAATAATATAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAA

IP21136.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:01:10
Subject Length Description Subject Range Query Range Score Percent Strand
CheA84a-RA 733 CheA84a-RA 68..651 1..584 2920 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:59:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 4030199..4030721 582..60 2615 100 Minus
chr3R 27901430 chr3R 4030775..4030834 60..1 300 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:44:36 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:59:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8204193..8204717 584..60 2625 100 Minus
3R 32079331 3R 8204771..8204830 60..1 300 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:56:52
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 7945024..7945548 584..60 2625 100 Minus
3R 31820162 3R 7945602..7945661 60..1 300 100 Minus
Blast to na_te.dros performed on 2019-03-16 06:59:17 has no hits.

IP21136.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:00:19 Download gff for IP21136.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 4030199..4030721 60..582 100 <- Minus
chr3R 4030776..4030834 1..59 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:23:45 Download gff for IP21136.complete
Subject Subject Range Query Range Percent Splice Strand
CG33779-RA 1..543 9..551 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:57:48 Download gff for IP21136.complete
Subject Subject Range Query Range Percent Splice Strand
CheA84a-RA 1..543 9..551 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:59:06 Download gff for IP21136.complete
Subject Subject Range Query Range Percent Splice Strand
CheA84a-RA 1..543 9..551 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:57:01 Download gff for IP21136.complete
Subject Subject Range Query Range Percent Splice Strand
CG33779-RA 1..543 9..551 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:24:05 Download gff for IP21136.complete
Subject Subject Range Query Range Percent Splice Strand
CheA84a-RA 1..543 9..551 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:22:08 Download gff for IP21136.complete
Subject Subject Range Query Range Percent Splice Strand
CG33779-RA 1..543 9..551 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:57:48 Download gff for IP21136.complete
Subject Subject Range Query Range Percent Splice Strand
CheA84a-RA 1..582 1..582 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:59:06 Download gff for IP21136.complete
Subject Subject Range Query Range Percent Splice Strand
CheA84a-RA 1..582 1..582 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:57:01 Download gff for IP21136.complete
Subject Subject Range Query Range Percent Splice Strand
CG33779-RA 1..543 9..551 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:24:05 Download gff for IP21136.complete
Subject Subject Range Query Range Percent Splice Strand
CheA84a-RA 1..582 1..582 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:00:19 Download gff for IP21136.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8204195..8204717 60..582 100 <- Minus
3R 8204772..8204830 1..59 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:00:19 Download gff for IP21136.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8204195..8204717 60..582 100 <- Minus
3R 8204772..8204830 1..59 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:00:19 Download gff for IP21136.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8204195..8204717 60..582 100 <- Minus
3R 8204772..8204830 1..59 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:59:06 Download gff for IP21136.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4029917..4030439 60..582 100 <- Minus
arm_3R 4030494..4030552 1..59 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:34:03 Download gff for IP21136.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7945026..7945548 60..582 100 <- Minus
3R 7945603..7945661 1..59 100   Minus

IP21136.pep Sequence

Translation from 2 to 550

> IP21136.pep
KTMKQFLFCVLIMLIGKTCALIPRTYETRFISITSNGTNLFDFSQIRFLG
RERMANGTFELKEDLDNESFSVVGETFIDSVGDGEYKQLPFTAPKQSVCT
ALKAYWSYFEPSIKYGVKTDFPAHTHPCPLPKGIYYIKDVVLKNDNWPVI
MPRGYLKAVANLFKNDEYGGSLEIVSQISDLS*

IP21136.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:44:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19868-PA 119 GF19868-PA 1..116 65..180 368 54.3 Plus
Dana\GF16169-PA 163 GF16169-PA 1..91 65..155 291 53.8 Plus
Dana\GF23621-PA 375 GF23621-PA 42..181 43..180 263 35.7 Plus
Dana\GF19770-PA 97 GF19770-PA 1..94 89..180 152 34 Plus
Dana\GF16169-PA 163 GF16169-PA 86..156 21..91 146 33.8 Plus
Dana\GF20005-PA 157 GF20005-PA 25..146 43..172 137 31.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:44:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17472-PA 179 GG17472-PA 1..179 3..182 680 68.9 Plus
Dere\GG17246-PA 186 GG17246-PA 1..179 3..180 332 36.9 Plus
Dere\GG13658-PA 184 GG13658-PA 1..181 3..180 272 33.3 Plus
Dere\GG25287-PA 181 GG25287-PA 50..178 46..180 147 28.1 Plus
Dere\GG21914-PA 178 GG21914-PA 9..176 11..181 143 27 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:44:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14453-PA 184 GH14453-PA 1..181 3..180 285 33.3 Plus
Dgri\GH22250-PA 184 GH22250-PA 1..181 3..180 279 32.8 Plus
Dgri\GH21867-PA 154 GH21867-PA 11..151 40..179 244 34 Plus
Dgri\GH21868-PA 157 GH21868-PA 15..148 42..174 236 31.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:36:43
Subject Length Description Subject Range Query Range Score Percent Strand
CheA84a-PA 180 CG33779-PA 1..180 3..182 954 100 Plus
CheA86a-PA 189 CG33698-PA 4..179 8..180 370 43.2 Plus
CheA75a-PA 184 CG7313-PA 1..181 3..180 268 32 Plus
CheA56a-PA 180 CG33724-PA 25..178 26..181 162 29.6 Plus
CheA46a-PA 177 CG33800-PA 8..173 10..179 160 29.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:44:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13589-PA 184 GI13589-PA 42..181 43..180 252 35 Plus
Dmoj\GI20367-PA 187 GI20367-PA 44..179 40..174 232 32.4 Plus
Dmoj\GI20369-PA 188 GI20369-PA 32..183 28..178 210 25.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:44:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23277-PA 316 GL23277-PA 158..314 24..180 399 42.7 Plus
Dper\GL22869-PA 184 GL22869-PA 42..181 43..180 258 35 Plus
Dper\GL11669-PA 141 GL11669-PA 6..129 46..176 155 28.8 Plus
Dper\GL17155-PA 147 GL17155-PA 3..144 32..180 150 27.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:44:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27206-PB 308 GA27206-PB 147..306 21..180 413 44.4 Plus
Dpse\GA20253-PA 184 GA20253-PA 42..181 43..180 258 35 Plus
Dpse\GA16964-PA 506 GA16964-PA 373..494 48..176 164 32.3 Plus
Dpse\GA25606-PB 176 GA25606-PB 32..173 32..180 156 27.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:44:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26365-PA 180 GM26365-PA 1..180 3..182 882 88.9 Plus
Dsec\GM26132-PA 185 GM26132-PA 4..179 8..180 371 42 Plus
Dsec\GM14971-PA 184 GM14971-PA 20..181 24..180 256 33.3 Plus
Dsec\GM21905-PA 179 GM21905-PA 25..176 26..180 157 31 Plus
Dsec\GM21148-PA 176 GM21148-PA 9..172 10..179 140 27.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:44:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20888-PA 180 GD20888-PA 1..180 3..182 888 90 Plus
Dsim\GD23770-PA 161 GD23770-PA 2..159 21..180 419 48.8 Plus
Dsim\GD15112-PA 185 GD15112-PA 4..179 8..180 368 41.5 Plus
Dsim\GD11401-PA 179 GD11401-PA 25..176 26..180 158 31.6 Plus
Dsim\GD10679-PA 176 GD10679-PA 9..164 10..170 144 28.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:44:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13928-PA 183 GJ13928-PA 31..181 32..180 264 34.4 Plus
Dvir\GJ22094-PA 165 GJ22094-PA 21..147 40..165 228 32.3 Plus
Dvir\GJ22095-PA 188 GJ22095-PA 33..183 29..178 207 25.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:44:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23998-PA 167 GK23998-PA 4..162 23..178 358 42.1 Plus
Dwil\GK18986-PA 167 GK18986-PA 1..166 19..182 351 42.5 Plus
Dwil\GK18985-PA 165 GK18985-PA 1..154 22..172 334 42.9 Plus
Dwil\GK19327-PA 176 GK19327-PA 4..160 23..173 316 38.2 Plus
Dwil\GK12881-PA 185 GK12881-PA 21..182 22..180 286 39.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:44:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24871-PA 180 GE24871-PA 1..180 3..182 765 79 Plus
Dyak\GE24649-PA 187 GE24649-PA 1..179 3..180 346 36.9 Plus
Dyak\GE19953-PA 184 GE19953-PA 1..181 3..180 275 33.1 Plus
Dyak\GE19299-PA 177 GE19299-PA 1..173 3..179 175 28.9 Plus
Dyak\GE11988-PA 178 GE11988-PA 3..175 7..180 164 31.5 Plus

IP21136.hyp Sequence

Translation from 2 to 550

> IP21136.hyp
KTMKQFLFCVLIMLIGKTCALIPRTYETRFISITSNGTNLFDFSQIRFLG
RERMANGTFELKEDLDNESFSVVGETFIDSVGDGEYKQLPFTAPKQSVCT
ALKAYWSYFEPSIKYGVKTDFPAHTHPCPLPKGIYYIKDVVLKNDNWPVI
MPRGYLKAVANLFKNDEYGGSLEIVSQISDLS*

IP21136.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:17:06
Subject Length Description Subject Range Query Range Score Percent Strand
CheA84a-PA 180 CG33779-PA 1..180 3..182 954 100 Plus
CheA86a-PA 189 CG33698-PA 4..179 8..180 370 43.2 Plus
CheA75a-PA 184 CG7313-PA 1..181 3..180 268 32 Plus
CheA56a-PA 180 CG33724-PA 25..178 26..181 162 29.6 Plus
CheA46a-PA 177 CG33800-PA 8..173 10..179 160 29.5 Plus