Clone IP21171 Report

Search the DGRC for IP21171

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:211
Well:71
Vector:pOT2
Associated Gene/TranscriptCG12498-RA
Protein status:IP21171.pep: gold
Sequenced Size:993

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12498 2008-04-29 Release 5.5 accounting
CG12498 2008-05-05 Release 5.5 slip selected
CG12498 2008-08-15 Release 5.9 accounting
CG12498 2008-12-18 5.12 accounting

Clone Sequence Records

IP21171.complete Sequence

993 bp assembled on 2008-05-14

GenBank Submission: BT031073

> IP21171.complete
TCAAGTAACAAGCCGAAACCCTTAAAAAATTGTTCGAATGTTGATTGAGG
AAACCTTTTTGGCGAAGCTCACATAAGCCCACTTAAATGTCTAACCAGCG
ATCCCGACACGTTCGTCGTCCGGCAGCGGAAATAGTCCGCGAACTGAGGA
ATCTTCGCGCCTCGCCTCTGCGGATCGACGACGAGAACGAGTCGTGGGTG
AATGGCTACGAGAAGCCACCAACTCCGGATCTACCGGTGACCAGTCGCGA
TCAGTTGGAGCTGCTACGTCTGAGCCGCCATCGAATCGGTCTGCTTCTGG
TTCGACCCGCCTTCGAGCAGGCCGTCACTGGATGCTTTGTCCGCGTGAAT
GTCAGTGGGCAGGGAGAGTTGCCTGATCATCGAATCGCCGAGGTGCTGGG
CATCTGCGAACTGGACTTTGGCTACAAAGTGGAGCAGATACCCACGAATG
TGGCGCTGCGATTGCGCTACGATGACCTGGAGATGCAGCACGAGATTAAC
GATGTCTCTAACCTGAACTTCACCCAGGAGGAATTCGAACTGTGGCGCGA
TAACTGTGTTAACCAGGCCATAAGTCCACCCACCACCCACATACTGACGC
GCAAGAAGGTCGAACTGTACAACGCACTGCAGTTGGAGGCCAAGCCTTTA
AGCCTGATCCAAAGGACCTTCTCCTTCGCCCTGAGGCCCCAGCAGAAAAT
CGGCATCATGGAGCGGCATGGCGTTGTTTATCCCTGGCAATTGAATCATT
CGCTCCCGTTCGTTTCGCAATCGCCAACTGAAAATCCATCGAGGGGAAAA
GCGGATACCGTAGACGAGGAGGAAGATCCGGGGGCAGCTGCTCCATTATT
ACCAAAAACTGAACCAAATTAATAGGCAATTGTTAATTTTTGAACATTTA
TTTAGCAAAGATAATGGCAATTGGTGGAACTTTTAATGGCTTGTTATCAT
AAATAATTACAGTCATAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP21171.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:58:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG12498-RA 786 CG12498-RA 1..786 87..872 3930 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:53:41
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 2703702..2704658 10..966 4710 99.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:44:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:53:39
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 2809881..2810848 1..968 4840 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:54:33
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 2817979..2818946 1..968 4840 100 Plus
Blast to na_te.dros performed 2019-03-15 20:53:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dbif\P-element_O 2986 Dbif\P-element_O P_O 2986bp Derived from X71634. 1182..1293 803..911 110 60.2 Plus

IP21171.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:54:22 Download gff for IP21171.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 2703690..2704658 1..966 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:23:48 Download gff for IP21171.complete
Subject Subject Range Query Range Percent Splice Strand
CG12498-RA 1..786 87..872 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:52:19 Download gff for IP21171.complete
Subject Subject Range Query Range Percent Splice Strand
CG12498-RA 1..786 87..872 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:31:06 Download gff for IP21171.complete
Subject Subject Range Query Range Percent Splice Strand
CG12498-RA 1..786 87..872 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:51:32 Download gff for IP21171.complete
Subject Subject Range Query Range Percent Splice Strand
CG12498-RA 1..786 87..872 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:37:26 Download gff for IP21171.complete
Subject Subject Range Query Range Percent Splice Strand
CG12498-RA 1..786 87..872 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:15:14 Download gff for IP21171.complete
Subject Subject Range Query Range Percent Splice Strand
CG12498-RA 1..786 87..872 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:52:19 Download gff for IP21171.complete
Subject Subject Range Query Range Percent Splice Strand
CG12498-RA 1..966 1..966 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:31:06 Download gff for IP21171.complete
Subject Subject Range Query Range Percent Splice Strand
CG12498-RA 1..966 1..966 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:51:32 Download gff for IP21171.complete
Subject Subject Range Query Range Percent Splice Strand
CG12498-RA 1..786 87..872 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:37:26 Download gff for IP21171.complete
Subject Subject Range Query Range Percent Splice Strand
CG12498-RA 1..966 1..966 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:54:22 Download gff for IP21171.complete
Subject Subject Range Query Range Percent Splice Strand
X 2809881..2810846 1..966 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:54:22 Download gff for IP21171.complete
Subject Subject Range Query Range Percent Splice Strand
X 2809881..2810846 1..966 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:54:22 Download gff for IP21171.complete
Subject Subject Range Query Range Percent Splice Strand
X 2809881..2810846 1..966 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:31:06 Download gff for IP21171.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 2703914..2704879 1..966 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:30:18 Download gff for IP21171.complete
Subject Subject Range Query Range Percent Splice Strand
X 2817979..2818944 1..966 100   Plus

IP21171.pep Sequence

Translation from 86 to 871

> IP21171.pep
MSNQRSRHVRRPAAEIVRELRNLRASPLRIDDENESWVNGYEKPPTPDLP
VTSRDQLELLRLSRHRIGLLLVRPAFEQAVTGCFVRVNVSGQGELPDHRI
AEVLGICELDFGYKVEQIPTNVALRLRYDDLEMQHEINDVSNLNFTQEEF
ELWRDNCVNQAISPPTTHILTRKKVELYNALQLEAKPLSLIQRTFSFALR
PQQKIGIMERHGVVYPWQLNHSLPFVSQSPTENPSRGKADTVDEEEDPGA
AAPLLPKTEPN*

IP21171.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:25:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22456-PA 295 GF22456-PA 29..241 7..219 837 70.4 Plus
Dana\GF11885-PA 781 GF11885-PA 433..568 51..186 226 33.1 Plus
Dana\GF21518-PA 587 GF21518-PA 244..375 51..182 186 32.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:25:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18631-PA 243 GG18631-PA 1..226 1..226 1055 86.7 Plus
Dere\GG22183-PA 776 GG22183-PA 429..564 51..186 222 32.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:25:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12472-PA 295 GH12472-PA 48..295 10..248 462 41.1 Plus
Dgri\GH21360-PA 796 GH21360-PA 448..583 51..186 219 33.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:51:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG12498-PA 261 CG12498-PA 1..261 1..261 1364 100 Plus
Rtf1-PB 775 CG10955-PB 419..563 42..186 237 33.1 Plus
Rtf1-PA 775 CG10955-PA 419..563 42..186 237 33.1 Plus
CG31702-PA 441 CG31702-PA 99..223 51..180 156 33.8 Plus
CG31703-PA 439 CG31703-PA 99..223 51..180 153 33.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:25:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11152-PA 360 GI11152-PA 50..264 11..219 459 43.7 Plus
Dmoj\GI20555-PA 777 GI20555-PA 422..566 42..186 220 33.1 Plus
Dmoj\GI17712-PA 457 GI17712-PA 143..292 34..181 157 27.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:25:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19928-PA 250 GL19928-PA 15..250 10..250 688 55.2 Plus
Dper\GL17538-PA 764 GL17538-PA 418..553 51..186 207 30.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:25:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11664-PA 247 GA11664-PA 15..219 10..219 673 60.5 Plus
Dpse\GA10665-PA 764 GA10665-PA 418..553 51..186 221 32.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:25:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19250-PA 261 GM19250-PA 1..261 1..261 1270 91.6 Plus
Dsec\GM15903-PA 775 GM15903-PA 428..563 51..186 225 33.1 Plus
Dsec\GM16155-PA 437 GM16155-PA 99..225 51..182 149 32.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:25:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16620-PA 241 GD16620-PA 1..219 1..219 1081 92.2 Plus
Dsim\GD11662-PA 775 GD11662-PA 428..563 51..186 225 33.1 Plus
Dsim\GD24344-PA 437 GD24344-PA 99..225 51..182 150 32.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:25:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18524-PA 311 GJ18524-PA 42..260 1..219 531 48.7 Plus
Dvir\GJ22408-PA 778 GJ22408-PA 432..567 51..186 218 33.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:25:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25522-PA 365 GK25522-PA 60..280 14..219 640 54.8 Plus
Dwil\GK20812-PA 831 GK20812-PA 461..605 42..186 215 31.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:25:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16284-PA 269 GE16284-PA 1..223 1..223 1051 88.3 Plus
Dyak\GE14177-PA 776 GE14177-PA 429..564 51..186 222 32.4 Plus

IP21171.hyp Sequence

Translation from 86 to 871

> IP21171.hyp
MSNQRSRHVRRPAAEIVRELRNLRASPLRIDDENESWVNGYEKPPTPDLP
VTSRDQLELLRLSRHRIGLLLVRPAFEQAVTGCFVRVNVSGQGELPDHRI
AEVLGICELDFGYKVEQIPTNVALRLRYDDLEMQHEINDVSNLNFTQEEF
ELWRDNCVNQAISPPTTHILTRKKVELYNALQLEAKPLSLIQRTFSFALR
PQQKIGIMERHGVVYPWQLNHSLPFVSQSPTENPSRGKADTVDEEEDPGA
AAPLLPKTEPN*

IP21171.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:17:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG12498-PA 261 CG12498-PA 1..261 1..261 1364 100 Plus
Rtf1-PB 775 CG10955-PB 419..563 42..186 237 33.1 Plus
Rtf1-PA 775 CG10955-PA 419..563 42..186 237 33.1 Plus
CG31702-PA 441 CG31702-PA 99..223 51..180 156 33.8 Plus
CG31703-PA 439 CG31703-PA 99..223 51..180 153 33.8 Plus