Clone IP21189 Report

Search the DGRC for IP21189

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:211
Well:89
Vector:pOT2
Associated Gene/TranscriptCpr65Ea-RA
Protein status:IP21189.pep: gold
Sequenced Size:587

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Cpr65Ea 2008-05-05 Release 5.5 slip selected

Clone Sequence Records

IP21189.complete Sequence

587 bp assembled on 2009-09-15

GenBank Submission: BT088803.1

> IP21189.complete
AACAAACCAGCAGCAGCAACATGTACAAGCTCCTTCTCGTCGTCGCCCTT
TTCGGATGCGCCCTGGCCGCGCCACTGAACGATGATACCATCACCAAGTT
CTTGGCCAACCAGGATACGGACGGCACCTACGCCTATGATATCGAGCAGG
CCAGCGGTATCCAGATCAAGGAGGAGGGTTTGGCCGGACACGAAGCTCAC
GGATCGTACTCCTACATCTCTCCCGAGGGTATTCCCGTCCAGGTGGTGTA
CACCGCCGATGAGTTCGGCTTCCACCCACAGTCCAACCTCCTGCCCACTC
CACCACCAATCCCAGAGGAGATCCTGCGCTCCATCCGCTACATCCAGGAG
CATCCCACTCCCGAGGAGCTGGCCGATCGTGCTGTTCGCGCCCAGCAGAT
CTAGAGCTGAATGGAAATTAGTAATCTTAAGTTTGCCAAAGTAGTCATCA
CACGATGTGTTCATCATCCCAGCCATCCGATTAAACCACAACCAGCTCTT
GGCTGGTGTTAATTCCACTTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP21189.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:31:46
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr65Ea-RA 861 Cpr65Ea-RA 171..691 1..521 2605 100 Plus
Lcp4-RA 690 Lcp4-RA 265..367 255..357 185 78.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:54:35
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 7078226..7078710 520..36 2380 99.4 Minus
chr2R 21145070 chr2R 4325504..4325606 255..357 185 78.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:44:45 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:54:34
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7086002..7086490 521..33 2445 100 Minus
2R 25286936 2R 8437978..8438080 255..357 185 78.6 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:48:10
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 7079102..7079590 521..33 2445 100 Minus
2R 25260384 2R 8439177..8439279 255..357 185 78.6 Plus
3L 28103327 3L 7079657..7079688 32..1 160 100 Minus
Blast to na_te.dros performed on 2019-03-16 06:54:34 has no hits.

IP21189.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:55:15 Download gff for IP21189.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 7078226..7078713 33..520 99 <- Minus
chr3L 7078780..7078811 1..32 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:54:17 Download gff for IP21189.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr65Ea-RA 1..384 21..404 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:47:35 Download gff for IP21189.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr65Ea-RA 1..384 21..404 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:34:20 Download gff for IP21189.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr65Ea-RA 1..384 21..404 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:22:48 Download gff for IP21189.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr65Ea-RA 1..384 21..404 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-15 10:26:13 Download gff for IP21189.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr65Ea-RA 19..485 1..467 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:47:35 Download gff for IP21189.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr65Ea-RA 19..485 1..467 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:34:20 Download gff for IP21189.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr65Ea-RA 21..540 1..520 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:22:48 Download gff for IP21189.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr65Ea-RA 21..540 1..520 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:55:15 Download gff for IP21189.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7086003..7086490 33..520 100 <- Minus
3L 7086557..7086588 1..32 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:55:15 Download gff for IP21189.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7086003..7086490 33..520 100 <- Minus
3L 7086557..7086588 1..32 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:55:15 Download gff for IP21189.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7086003..7086490 33..520 100 <- Minus
3L 7086557..7086588 1..32 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:34:20 Download gff for IP21189.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7079103..7079590 33..520 100 <- Minus
arm_3L 7079657..7079688 1..32 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:23:03 Download gff for IP21189.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7079103..7079590 33..520 100 <- Minus
3L 7079657..7079688 1..32 100   Minus

IP21189.hyp Sequence

Translation from 2 to 403

> IP21189.hyp
QTSSSNMYKLLLVVALFGCALAAPLNDDTITKFLANQDTDGTYAYDIEQA
SGIQIKEEGLAGHEAHGSYSYISPEGIPVQVVYTADEFGFHPQSNLLPTP
PPIPEEILRSIRYIQEHPTPEELADRAVRAQQI*

IP21189.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:18:00
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr65Ea-PA 127 CG8640-PA 1..127 7..133 661 100 Plus
Edg78E-PB 122 CG7673-PB 1..113 7..118 267 47.4 Plus
Edg78E-PA 122 CG7673-PA 1..113 7..118 267 47.4 Plus
Cpr67Fa1-PA 134 CG7941-PA 1..117 7..118 255 47 Plus
Cpr67Fa2-PA 134 CG18349-PA 1..117 7..118 252 46.2 Plus

IP21189.pep Sequence

Translation from 2 to 403

> IP21189.pep
QTSSSNMYKLLLVVALFGCALAAPLNDDTITKFLANQDTDGTYAYDIEQA
SGIQIKEEGLAGHEAHGSYSYISPEGIPVQVVYTADEFGFHPQSNLLPTP
PPIPEEILRSIRYIQEHPTPEELADRAVRAQQI*

IP21189.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:55:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24794-PA 127 GF24794-PA 1..127 7..133 501 86.6 Plus
Dana\GF24202-PA 115 GF24202-PA 1..108 7..118 237 42.1 Plus
Dana\GF10617-PA 121 GF10617-PA 1..114 7..118 235 39.5 Plus
Dana\GF24793-PA 181 GF24793-PA 43..124 40..121 215 50 Plus
Dana\GF10274-PA 119 GF10274-PA 37..116 38..118 213 53.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:55:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15000-PA 127 GG15000-PA 1..127 7..133 546 92.1 Plus
Dere\GG15001-PA 127 GG15001-PA 1..127 7..133 546 92.1 Plus
Dere\GG13245-PA 121 GG13245-PA 1..113 7..118 266 46.5 Plus
Dere\GG15456-PA 134 GG15456-PA 1..117 7..118 244 43.6 Plus
Dere\GG15458-PA 134 GG15458-PA 22..117 23..118 241 49 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:55:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16085-PA 131 GH16085-PA 1..130 7..132 309 53.1 Plus
Dgri\GH16160-PA 120 GH16160-PA 1..113 7..118 256 43.5 Plus
Dgri\GH20994-PA 124 GH20994-PA 1..121 7..122 240 41 Plus
Dgri\GH16083-PA 123 GH16083-PA 7..115 10..118 225 39.4 Plus
Dgri\GH15388-PA 153 GH15388-PA 1..121 7..124 217 45.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:44:03
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr65Ea-PA 127 CG8640-PA 1..127 7..133 661 100 Plus
Edg78E-PB 122 CG7673-PB 1..113 7..118 267 47.4 Plus
Edg78E-PA 122 CG7673-PA 1..113 7..118 267 47.4 Plus
Cpr67Fa1-PA 134 CG7941-PA 1..117 7..118 255 47 Plus
Cpr67Fa2-PA 134 CG18349-PA 1..117 7..118 252 46.2 Plus
Cpr67Fb-PA 122 CG18348-PA 1..114 7..118 239 42.1 Plus
Cpr78Cc-PA 119 CG7658-PA 1..116 7..118 228 46.2 Plus
Cpr65Ec-PA 127 CG8634-PA 2..119 6..121 227 40.7 Plus
Cpr65Eb-PA 179 CG8638-PA 43..121 40..118 219 51.9 Plus
Cpr49Aa-PB 144 CG30045-PB 43..133 40..122 218 47.3 Plus
Lcp4-PB 112 CG2044-PB 1..112 7..121 207 41.7 Plus
Lcp4-PA 112 CG2044-PA 1..112 7..121 207 41.7 Plus
Cpr47Ef-PD 601 CG13214-PD 136..225 30..111 201 45.6 Plus
Cpr47Ef-PC 612 CG13214-PC 136..225 30..111 201 45.6 Plus
Lcp2-PB 126 CG8697-PB 1..121 7..122 199 36.4 Plus
Lcp2-PA 126 CG8697-PA 1..121 7..122 199 36.4 Plus
Cpr78Cb-PB 140 CG7663-PB 32..128 21..117 195 41.8 Plus
Cpr78Cb-PA 140 CG7663-PA 32..128 21..117 195 41.8 Plus
Lcp1-PB 130 CG11650-PB 1..125 7..122 194 33.6 Plus
Lcp1-PA 130 CG11650-PA 1..125 7..122 194 33.6 Plus
Cpr49Af-PB 126 CG8510-PB 2..124 9..122 193 36.3 Plus
Cpr49Af-PA 126 CG8510-PA 2..124 9..122 193 36.3 Plus
Cpr65Az-PA 239 CG12330-PA 113..206 27..111 192 43.6 Plus
Pcp-PA 184 CG3440-PA 25..117 26..118 188 42.7 Plus
Lcp3-PB 112 CG2043-PB 1..110 7..119 186 40 Plus
Lcp3-PA 112 CG2043-PA 1..110 7..119 186 40 Plus
Cpr49Ae-PA 134 CG8505-PA 3..129 6..118 181 38.6 Plus
Cpr47Eg-PA 117 CG9070-PA 7..114 17..118 174 41.3 Plus
Cpr78Ca-PA 127 CG11310-PA 9..125 7..126 158 34.1 Plus
Cpr49Ah-PA 190 CG8515-PA 53..146 30..114 156 40.4 Plus
Cpr65Ax2-PB 102 CG18777-PB 5..100 11..101 145 39.4 Plus
Cpr65Ax2-PA 102 CG18777-PA 5..100 11..101 145 39.4 Plus
Cpr65Ax1-PA 102 CG34270-PA 5..100 11..101 145 39.4 Plus
Cpr100A-PA 241 CG12045-PA 1..111 7..113 139 31.5 Plus
Cpr47Ea-PA 135 CG9079-PA 53..124 40..103 135 36.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:55:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12348-PA 306 GI12348-PA 20..125 24..129 315 53.8 Plus
Dmoj\GI20906-PA 117 GI20906-PA 1..117 7..123 252 43.7 Plus
Dmoj\GI13312-PA 120 GI13312-PA 1..113 7..118 249 43 Plus
Dmoj\GI12994-PA 134 GI12994-PA 1..117 7..122 243 47 Plus
Dmoj\GI19544-PA 132 GI19544-PA 1..122 7..126 241 40.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:55:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25148-PA 127 GL25148-PA 1..127 7..133 460 79.5 Plus
Dper\GL24590-PA 121 GL24590-PA 1..113 7..118 245 42.1 Plus
Dper\GL11748-PA 122 GL11748-PA 1..114 7..118 242 43 Plus
Dper\GL24679-PA 120 GL24679-PA 1..120 7..122 221 43.9 Plus
Dper\GL24678-PA 119 GL24678-PA 1..119 7..121 198 40.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:55:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21230-PA 127 GA21230-PA 1..127 7..133 460 79.5 Plus
Dpse\GA14899-PA 122 GA14899-PA 1..114 7..118 242 43 Plus
Dpse\GA20516-PA 121 GA20516-PA 1..113 7..118 241 41.2 Plus
Dpse\GA21228-PA 183 GA21228-PA 47..125 40..118 228 54.4 Plus
Dpse\GA23698-PA 190 GA23698-PA 47..129 40..122 228 53 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:55:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13791-PA 127 GM13791-PA 1..127 7..133 573 96.1 Plus
Dsec\GM22150-PA 122 GM22150-PA 1..113 7..118 267 47.4 Plus
Dsec\GM25234-PA 122 GM25234-PA 1..114 7..118 235 42.1 Plus
Dsec\GM13790-PA 179 GM13790-PA 2..121 3..118 214 40.8 Plus
Dsec\GM21031-PA 112 GM21031-PA 1..112 7..121 210 41.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:55:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17593-PA 127 GD17593-PA 1..127 7..133 646 96.1 Plus
Dsim\GD12126-PA 122 GD12126-PA 1..113 7..118 267 47.4 Plus
Dsim\GD14266-PA 116 GD14266-PA 5..116 10..117 227 42.9 Plus
Dsim\GD13091-PA 179 GD13091-PA 2..121 3..118 214 40.8 Plus
Dsim\GD14949-PA 120 GD14949-PA 37..116 38..118 204 50.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:55:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12239-PA 129 GJ12239-PA 20..129 24..133 337 60 Plus
Dvir\GJ21116-PA 156 GJ21116-PA 22..143 7..126 256 41.8 Plus
Dvir\GJ12082-PA 120 GJ12082-PA 1..113 7..118 255 44.7 Plus
Dvir\GJ13137-PA 139 GJ13137-PA 1..120 7..124 242 42.5 Plus
Dvir\GJ12237-PA 123 GJ12237-PA 1..115 7..118 239 41.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:55:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17541-PA 136 GK17541-PA 22..136 19..133 407 67.8 Plus
Dwil\GK20425-PA 121 GK20425-PA 1..114 7..119 238 41.7 Plus
Dwil\GK17540-PA 191 GK17540-PA 1..122 7..118 234 42.6 Plus
Dwil\GK21874-PA 192 GK21874-PA 68..183 9..122 227 42 Plus
Dwil\GK20466-PA 121 GK20466-PA 2..117 7..118 224 43.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:55:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20446-PA 127 GE20446-PA 1..127 7..133 537 89.8 Plus
Dyak\GE20447-PA 127 GE20447-PA 1..127 7..133 537 89.8 Plus
Dyak\GE22345-PA 121 GE22345-PA 1..113 7..118 257 45.6 Plus
Dyak\GE22714-PA 120 GE22714-PA 4..112 11..118 239 44.5 Plus
Dyak\GE21770-PA 122 GE21770-PA 1..114 7..118 235 41.2 Plus