IP21203.complete Sequence
522 bp assembled on 2009-04-14
GenBank Submission: BT082044.1
> IP21203.complete
TAAGAGCCCAATGGCCAACGATCCCGGTAAGCCGGAAAAGTCCAGGCCAC
GCTTCTGCACCCTGTTGAACCATGAGGTCGTCGATCCCAAAGAGTTCATG
GTGCACTTCGCCAAGCGGAGGAAGAATGAAATCATAATCCAGGGTCAGGT
CTGCGGTTGGTGCTACAACATAGATTACTTAAAAGATGAAAAAACAAAGT
TCAAGAAGAAGCGGCCCAATCTTTCGGATGCGAGCGTCACCAAGCAGCGC
GCCACCTCACCACGAAGAGGAGCAATTGCAGACAACCCTCGTCAATTGGG
TGGTGATCAGCACTGCTCGGAAAAGAGTTTTGCGCCCTCTGGTGACGAAA
TACCCACACCACGTGATTTGAAGGACAAACCTGGTGACCTTGCCTAAGGT
CCGATACTGAAGTGGCCATAAAGCGATTTCAATTTGTAACATGTTTTCAT
TGATATAATCCAATAAATGATACGCCGGCTGTCTTGAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAA
IP21203.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:30:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13540.a | 566 | CG13540.a | 60..548 | 1..489 | 2445 | 100 | Plus |
CG13540-RA | 484 | CG13540-RA | 1..479 | 11..489 | 2395 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:58:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 19156962..19157437 | 11..486 | 2350 | 99.6 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:44:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:58:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 23270584..23271062 | 11..489 | 2395 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:47:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 23271783..23272261 | 11..489 | 2395 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 15:58:22 has no hits.
IP21203.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:59:25 Download gff for
IP21203.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 19156962..19157437 | 11..486 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:49:55 Download gff for
IP21203.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13540-RA | 1..387 | 11..397 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:45:45 Download gff for
IP21203.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13540-RA | 1..387 | 11..397 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:22:56 Download gff for
IP21203.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13540-RB | 12..408 | 1..397 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:51:33 Download gff for
IP21203.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13540-RB | 12..408 | 1..397 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-04-14 17:58:36 Download gff for
IP21203.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13540-RA | 1..476 | 11..486 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:45:45 Download gff for
IP21203.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13540-RA | 1..476 | 11..486 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:22:56 Download gff for
IP21203.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13540-RB | 43..528 | 1..486 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:51:33 Download gff for
IP21203.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13540-RB | 43..528 | 1..486 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:59:25 Download gff for
IP21203.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 23270584..23271059 | 11..486 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:59:25 Download gff for
IP21203.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 23270584..23271059 | 11..486 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:59:25 Download gff for
IP21203.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 23270584..23271059 | 11..486 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:22:56 Download gff for
IP21203.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 19158107..19158582 | 11..486 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:21:05 Download gff for
IP21203.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 23271801..23272276 | 11..486 | 100 | | Plus |
IP21203.pep Sequence
Translation from 1 to 396
> IP21203.pep
KSPMANDPGKPEKSRPRFCTLLNHEVVDPKEFMVHFAKRRKNEIIIQGQV
CGWCYNIDYLKDEKTKFKKKRPNLSDASVTKQRATSPRRGAIADNPRQLG
GDQHCSEKSFAPSGDEIPTPRDLKDKPGDLA*
IP21203.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:35:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG22836-PA | 115 | GG22836-PA | 1..72 | 4..76 | 237 | 60.3 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:03:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13540-PB | 135 | CG13540-PB | 5..135 | 1..131 | 710 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:35:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM15994-PA | 142 | GM15994-PA | 5..142 | 1..131 | 451 | 66.7 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:35:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD11746-PA | 221 | GD11746-PA | 76..221 | 5..131 | 448 | 62.3 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:35:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE14272-PA | 125 | GE14272-PA | 1..67 | 4..71 | 234 | 58.8 | Plus |
IP21203.hyp Sequence
Translation from 11 to 396
> IP21203.hyp
MANDPGKPEKSRPRFCTLLNHEVVDPKEFMVHFAKRRKNEIIIQGQVCGW
CYNIDYLKDEKTKFKKKRPNLSDASVTKQRATSPRRGAIADNPRQLGGDQ
HCSEKSFAPSGDEIPTPRDLKDKPGDLA*
IP21203.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:18:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13540-PB | 135 | CG13540-PB | 8..135 | 1..128 | 694 | 100 | Plus |