Clone IP21203 Report

Search the DGRC for IP21203

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:212
Well:3
Vector:pOT2
Associated Gene/TranscriptCG13540-RA
Protein status:IP21203.pep: wuzgold
Sequenced Size:522

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13540 2008-05-05 Release 5.5 slip selected

Clone Sequence Records

IP21203.complete Sequence

522 bp assembled on 2009-04-14

GenBank Submission: BT082044.1

> IP21203.complete
TAAGAGCCCAATGGCCAACGATCCCGGTAAGCCGGAAAAGTCCAGGCCAC
GCTTCTGCACCCTGTTGAACCATGAGGTCGTCGATCCCAAAGAGTTCATG
GTGCACTTCGCCAAGCGGAGGAAGAATGAAATCATAATCCAGGGTCAGGT
CTGCGGTTGGTGCTACAACATAGATTACTTAAAAGATGAAAAAACAAAGT
TCAAGAAGAAGCGGCCCAATCTTTCGGATGCGAGCGTCACCAAGCAGCGC
GCCACCTCACCACGAAGAGGAGCAATTGCAGACAACCCTCGTCAATTGGG
TGGTGATCAGCACTGCTCGGAAAAGAGTTTTGCGCCCTCTGGTGACGAAA
TACCCACACCACGTGATTTGAAGGACAAACCTGGTGACCTTGCCTAAGGT
CCGATACTGAAGTGGCCATAAAGCGATTTCAATTTGTAACATGTTTTCAT
TGATATAATCCAATAAATGATACGCCGGCTGTCTTGAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAA

IP21203.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:30:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG13540.a 566 CG13540.a 60..548 1..489 2445 100 Plus
CG13540-RA 484 CG13540-RA 1..479 11..489 2395 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:58:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19156962..19157437 11..486 2350 99.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:44:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:58:21
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23270584..23271062 11..489 2395 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:47:07
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23271783..23272261 11..489 2395 100 Plus
Blast to na_te.dros performed on 2019-03-16 15:58:22 has no hits.

IP21203.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:59:25 Download gff for IP21203.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19156962..19157437 11..486 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:49:55 Download gff for IP21203.complete
Subject Subject Range Query Range Percent Splice Strand
CG13540-RA 1..387 11..397 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:45:45 Download gff for IP21203.complete
Subject Subject Range Query Range Percent Splice Strand
CG13540-RA 1..387 11..397 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:22:56 Download gff for IP21203.complete
Subject Subject Range Query Range Percent Splice Strand
CG13540-RB 12..408 1..397 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:51:33 Download gff for IP21203.complete
Subject Subject Range Query Range Percent Splice Strand
CG13540-RB 12..408 1..397 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-04-14 17:58:36 Download gff for IP21203.complete
Subject Subject Range Query Range Percent Splice Strand
CG13540-RA 1..476 11..486 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:45:45 Download gff for IP21203.complete
Subject Subject Range Query Range Percent Splice Strand
CG13540-RA 1..476 11..486 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:22:56 Download gff for IP21203.complete
Subject Subject Range Query Range Percent Splice Strand
CG13540-RB 43..528 1..486 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:51:33 Download gff for IP21203.complete
Subject Subject Range Query Range Percent Splice Strand
CG13540-RB 43..528 1..486 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:59:25 Download gff for IP21203.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23270584..23271059 11..486 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:59:25 Download gff for IP21203.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23270584..23271059 11..486 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:59:25 Download gff for IP21203.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23270584..23271059 11..486 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:22:56 Download gff for IP21203.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19158107..19158582 11..486 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:21:05 Download gff for IP21203.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23271801..23272276 11..486 100   Plus

IP21203.pep Sequence

Translation from 1 to 396

> IP21203.pep
KSPMANDPGKPEKSRPRFCTLLNHEVVDPKEFMVHFAKRRKNEIIIQGQV
CGWCYNIDYLKDEKTKFKKKRPNLSDASVTKQRATSPRRGAIADNPRQLG
GDQHCSEKSFAPSGDEIPTPRDLKDKPGDLA*

IP21203.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:35:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22836-PA 115 GG22836-PA 1..72 4..76 237 60.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:03:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG13540-PB 135 CG13540-PB 5..135 1..131 710 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:35:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15994-PA 142 GM15994-PA 5..142 1..131 451 66.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:35:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11746-PA 221 GD11746-PA 76..221 5..131 448 62.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:35:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14272-PA 125 GE14272-PA 1..67 4..71 234 58.8 Plus

IP21203.hyp Sequence

Translation from 11 to 396

> IP21203.hyp
MANDPGKPEKSRPRFCTLLNHEVVDPKEFMVHFAKRRKNEIIIQGQVCGW
CYNIDYLKDEKTKFKKKRPNLSDASVTKQRATSPRRGAIADNPRQLGGDQ
HCSEKSFAPSGDEIPTPRDLKDKPGDLA*

IP21203.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:18:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG13540-PB 135 CG13540-PB 8..135 1..128 694 100 Plus