Clone IP21248 Report

Search the DGRC for IP21248

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:212
Well:48
Vector:pOT2
Associated Gene/TranscriptCG34148-RB
Protein status:IP21248.pep: gold
Sequenced Size:579

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34148 2008-05-05 Release 5.5 slip selected
CG34148 2008-08-15 Release 5.9 accounting
CG33092 2008-08-15 Release 5.9 accounting
CG34148 2008-12-18 5.12 accounting
CG33092 2008-12-18 5.12 accounting

Clone Sequence Records

IP21248.complete Sequence

579 bp assembled on 2008-05-14

GenBank Submission: BT032967

> IP21248.complete
ACAAAACCCATGAAAGCCAATTGTTATTATTTTGTGATGCAATAGTTTCA
ATATTTGGATACAAAATGCAGCTTACCCGCCTTTTACTGAAGCCTCGAGC
CTCGGAAGTATTGACCGCATATTTGAAACAATGCCATGAGCCACCTTGGA
CATCATATTTCGTGAAGTTTCACGATGTGGCCAACGATCAGAGGGGAATG
TCTCACTTTAATTGGACCCTGGAAAACGGAACCAACTATCACATTCTTCG
CACCGCCTGTTATCCCTATATGAAGTACCACTGTAGCAAGAGGGAGGTGC
AGGATCTTTGGCTGGAGGACAAGTTCTTTCGCTTCCTTAAGGTGATTAAT
TTGGGCTTACCAATGCTCTTCTATGGACTGGCTGCCATCCGTCTAATTAG
TCACACCGAGATCGTTCATGTCAGCGAGACGGTAAAAGTTCCCATATACT
TTCTATATCCTGAGGACAAGGGCTCAAGCTTTTGATTTGATTTCCTGAAC
TCCAAAATGTGAAATGTGAAGAAAAGCCTTCTTATCTAAATATATGCATA
TTCAGTTAATGTAAAAAAAAAAAAAAAAA

IP21248.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:00:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG34148-RB 666 CG34148-RB 34..597 1..564 2820 100 Plus
CG34148-RA 582 CG34148-RA 34..375 1..342 1710 100 Plus
CG34148-RA 582 CG34148-RA 374..582 354..562 1045 100 Plus
CG33092.e 2472 CG33092.e 297..486 355..166 950 100 Minus
CG33092.e 2472 CG33092.e 1..143 496..354 715 100 Minus
CG33092.e 2472 CG33092.e 552..642 167..77 455 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:25:25
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 17701586..17701794 562..354 1030 99.5 Minus
chr3R 27901430 chr3R 17701948..17702137 355..166 950 100 Minus
chr3R 27901430 chr3R 17702203..17702369 167..1 835 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:44:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:25:23
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21877868..21878078 564..354 1055 100 Minus
3R 32079331 3R 21878232..21878421 355..166 950 100 Minus
3R 32079331 3R 21878487..21878653 167..1 835 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:56:45
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 21618699..21618909 564..354 1055 100 Minus
3R 31820162 3R 21619063..21619252 355..166 950 100 Minus
3R 31820162 3R 21619318..21619484 167..1 835 100 Minus
Blast to na_te.dros performed on 2019-03-16 13:25:23 has no hits.

IP21248.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:26:09 Download gff for IP21248.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 17701586..17701793 355..562 99 <- Minus
chr3R 17701949..17702135 168..354 100 <- Minus
chr3R 17702203..17702369 1..167 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:24:21 Download gff for IP21248.complete
Subject Subject Range Query Range Percent Splice Strand
CG34148-RA 1..318 66..396 96   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:57:34 Download gff for IP21248.complete
Subject Subject Range Query Range Percent Splice Strand
CG34148-RB 1..420 66..485 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:28:18 Download gff for IP21248.complete
Subject Subject Range Query Range Percent Splice Strand
CG34148-RB 1..420 66..485 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:56:33 Download gff for IP21248.complete
Subject Subject Range Query Range Percent Splice Strand
CG34148-RA 1..318 66..396 96   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:19:10 Download gff for IP21248.complete
Subject Subject Range Query Range Percent Splice Strand
CG34148-RB 1..420 66..485 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:21:39 Download gff for IP21248.complete
Subject Subject Range Query Range Percent Splice Strand
CG34148-RA 1..430 23..465 97   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:57:34 Download gff for IP21248.complete
Subject Subject Range Query Range Percent Splice Strand
CG34148-RB 34..595 1..562 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:28:18 Download gff for IP21248.complete
Subject Subject Range Query Range Percent Splice Strand
CG34148-RB 34..595 1..562 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:56:33 Download gff for IP21248.complete
Subject Subject Range Query Range Percent Splice Strand
CG34148-RA 1..430 23..465 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:19:10 Download gff for IP21248.complete
Subject Subject Range Query Range Percent Splice Strand
CG34148-RB 34..595 1..562 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:26:09 Download gff for IP21248.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21877870..21878077 355..562 100 <- Minus
3R 21878233..21878419 168..354 100 <- Minus
3R 21878487..21878653 1..167 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:26:09 Download gff for IP21248.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21877870..21878077 355..562 100 <- Minus
3R 21878233..21878419 168..354 100 <- Minus
3R 21878487..21878653 1..167 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:26:09 Download gff for IP21248.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21877870..21878077 355..562 100 <- Minus
3R 21878233..21878419 168..354 100 <- Minus
3R 21878487..21878653 1..167 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:28:18 Download gff for IP21248.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 17703955..17704141 168..354 100 <- Minus
arm_3R 17703592..17703799 355..562 100 <- Minus
arm_3R 17704209..17704375 1..167 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:33:52 Download gff for IP21248.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21618701..21618908 355..562 100 <- Minus
3R 21619064..21619250 168..354 100 <- Minus
3R 21619318..21619484 1..167 100   Minus

IP21248.pep Sequence

Translation from 2 to 484

> IP21248.pep
KTHESQLLLFCDAIVSIFGYKMQLTRLLLKPRASEVLTAYLKQCHEPPWT
SYFVKFHDVANDQRGMSHFNWTLENGTNYHILRTACYPYMKYHCSKREVQ
DLWLEDKFFRFLKVINLGLPMLFYGLAAIRLISHTEIVHVSETVKVPIYF
LYPEDKGSSF*

IP21248.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:25:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16957-PA 95 GF16957-PA 1..95 66..160 459 88.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:25:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12552-PA 110 GG12552-PA 4..110 54..160 568 96.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG34148-PB 139 CG34148-PB 1..139 22..160 756 100 Plus
CG34148-PD 95 CG34148-PD 1..95 66..160 518 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:25:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23732-PA 95 GL23732-PA 1..95 66..160 468 90.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:25:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26721-PA 95 GA26721-PA 1..95 66..160 468 90.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:25:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23684-PA 95 GM23684-PA 1..95 66..160 514 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:25:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18494-PA 95 GD18494-PA 1..95 66..160 514 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:25:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22929-PA 95 GJ22929-PA 1..95 66..160 459 89.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:25:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22836-PA 95 GK22836-PA 1..95 66..160 465 89.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:25:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24077-PA 116 GE24077-PA 10..116 54..160 567 96.3 Plus

IP21248.hyp Sequence

Translation from 2 to 484

> IP21248.hyp
KTHESQLLLFCDAIVSIFGYKMQLTRLLLKPRASEVLTAYLKQCHEPPWT
SYFVKFHDVANDQRGMSHFNWTLENGTNYHILRTACYPYMKYHCSKREVQ
DLWLEDKFFRFLKVINLGLPMLFYGLAAIRLISHTEIVHVSETVKVPIYF
LYPEDKGSSF*

IP21248.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:18:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG34148-PB 139 CG34148-PB 1..139 22..160 756 100 Plus
CG34148-PC 70 CG34148-PC 1..34 22..55 182 100 Plus