Clone IP21249 Report

Search the DGRC for IP21249

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:212
Well:49
Vector:pOT2
Associated Gene/TranscriptCG15528-RB
Protein status:IP21249.pep: gold
Sequenced Size:1053

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15528 2008-05-05 Release 5.5 slip selected
CG15528 2008-08-15 Release 5.9 accounting
CG15528 2008-12-18 5.12 accounting

Clone Sequence Records

IP21249.complete Sequence

1053 bp assembled on 2008-05-15

GenBank Submission: BT032968

> IP21249.complete
TTCCCAAAAGAACTTCAGTTTGTTTACCGAATCGAATCGAATCGAATTGA
ATCGTTGGAGAGCGAGCAAGGCGGAAAATAATTTTTAATTTTGGCCTGGA
ATCCGCGGAATTCGTTTATTGTTTAGCGCAAATTCCCGACTAAGTGGCCA
GCGCGAATTTGTGAGCCCATAAACATGCAGGAGTTAATAGTCGGCGGCAT
CGCCATCAGTGGCGTTCCCTTCGCCAATGAGACGGTCGAGAAGGAAAGTC
GCCAGAATCAGCTGAGTGCATCCACGCTAGAGGATCACACGCCGTTTCCC
GGTCTGTCCCGCATCACTCCATCGCTGATCCTTTGCGGTGCCGCGGCGGT
GGTGCCCGCCTACATGGACAAACTGGGCGTGAGCTGCGTCATCAACGTGG
CGCCCGAGCTGCCGGACACACCACTGCCCAGCCAGAAGAACCCGCTCTAT
CTCCGCATCATGGCCCAGGATCGCTCCGAGGTGGACTTGGCCAAGCATTT
TGACGAGGCGGCCGATCTGATCGAGGAGGTGCATCTCTCCGGCGGCTGCA
CGTTGATCCACTGCGTGGCCGGCGTCAGCCGCTCGGCCAGCCTGTGCCTG
GCCTATCTAATGAAGCACGCCGGGATGAGCTTGCGCGAGGCCTACAAGCA
TGTGCAGGCCATACGTCCGCAGGTTCGCCCGAACTCCGGATTCTTCCAGC
AGCTGCGACGGTACGAGCAACAGCTGCGGGGCAGCAGCTCGGTGGCCATG
GTGTACTTCGCCTCGCTGGACAAGGAGATCCCCGACATACTGGAGCCCGA
GTACAGGGCCATGGAGGACTTCTACCAGCGCTACCGCAGCTCCCTCAAGA
GGCGATAGGCCCGTTGTGCCGCAATTAATCTTACTTGTGATACTCGTACC
CTACCACTAGCCTTAGATTAGATGTTTAAGTTGTGTGTGCTTAATGATAA
TGAAATGAAATGCTGAAACTTACATAAGATGTACGCTTAAGCCTCGTTCG
TAATTACAAATACACTTTTATTTTCGTTTAAGAAAAAAAAAAAAAAAAAA
AAA

IP21249.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:02:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG15528.a 1043 CG15528.a 31..1043 1..1013 5065 100 Plus
CG15528-RA 639 CG15528-RA 39..639 258..858 3005 100 Plus
CG7946.b 2810 CG7946.b 282..538 257..1 1285 100 Minus
CG7946.b 2810 CG7946.b 1..42 299..258 210 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:53:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 25871050..25871824 1032..258 3875 100 Minus
chr3R 27901430 chr3R 25874271..25874527 257..1 1285 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:44:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:53:21
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30048633..30049409 1034..258 3885 100 Minus
3R 32079331 3R 30051856..30052112 257..1 1285 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:57:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 29789464..29790240 1034..258 3885 100 Minus
3R 31820162 3R 29792687..29792943 257..1 1285 100 Minus
Blast to na_te.dros performed on 2019-03-15 20:53:22 has no hits.

IP21249.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:54:14 Download gff for IP21249.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 25871050..25871824 258..1032 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:24:22 Download gff for IP21249.complete
Subject Subject Range Query Range Percent Splice Strand
CG15528-RA 39..639 258..858 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:59:48 Download gff for IP21249.complete
Subject Subject Range Query Range Percent Splice Strand
CG15528-RB 1..684 175..858 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:30:41 Download gff for IP21249.complete
Subject Subject Range Query Range Percent Splice Strand
CG15528-RB 1..684 175..858 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:59:22 Download gff for IP21249.complete
Subject Subject Range Query Range Percent Splice Strand
CG15528-RA 39..639 258..858 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:36:58 Download gff for IP21249.complete
Subject Subject Range Query Range Percent Splice Strand
CG15528-RB 1..684 175..858 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:24:59 Download gff for IP21249.complete
Subject Subject Range Query Range Percent Splice Strand
CG15528-RA 39..639 258..858 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:59:48 Download gff for IP21249.complete
Subject Subject Range Query Range Percent Splice Strand
CG15528-RB 1..1032 1..1032 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:30:41 Download gff for IP21249.complete
Subject Subject Range Query Range Percent Splice Strand
CG15528-RB 1..1032 1..1032 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:59:22 Download gff for IP21249.complete
Subject Subject Range Query Range Percent Splice Strand
CG15528-RA 39..639 258..858 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:36:58 Download gff for IP21249.complete
Subject Subject Range Query Range Percent Splice Strand
CG15528-RB 1..1032 1..1032 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:54:14 Download gff for IP21249.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30048635..30049409 258..1032 100 <- Minus
3R 30051856..30052112 1..257 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:54:14 Download gff for IP21249.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30048635..30049409 258..1032 100 <- Minus
3R 30051856..30052112 1..257 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:54:14 Download gff for IP21249.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30048635..30049409 258..1032 100 <- Minus
3R 30051856..30052112 1..257 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:30:41 Download gff for IP21249.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25874357..25875131 258..1032 100 <- Minus
arm_3R 25877578..25877834 1..257 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:35:25 Download gff for IP21249.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29789466..29790240 258..1032 100 <- Minus
3R 29792687..29792943 1..257 100   Minus

IP21249.pep Sequence

Translation from 174 to 857

> IP21249.pep
MQELIVGGIAISGVPFANETVEKESRQNQLSASTLEDHTPFPGLSRITPS
LILCGAAAVVPAYMDKLGVSCVINVAPELPDTPLPSQKNPLYLRIMAQDR
SEVDLAKHFDEAADLIEEVHLSGGCTLIHCVAGVSRSASLCLAYLMKHAG
MSLREAYKHVQAIRPQVRPNSGFFQQLRRYEQQLRGSSSVAMVYFASLDK
EIPDILEPEYRAMEDFYQRYRSSLKRR*

IP21249.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:50:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16206-PA 225 GF16206-PA 1..225 1..227 1003 82.8 Plus
Dana\GF10784-PA 461 GF10784-PA 223..362 47..185 241 39.9 Plus
Dana\GF16724-PA 491 GF16724-PA 159..281 67..191 231 40.5 Plus
Dana\GF24925-PA 203 GF24925-PA 88..200 66..179 197 37.4 Plus
Dana\GF10970-PA 443 GF10970-PA 24..140 62..182 188 35.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:50:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11968-PA 227 GG11968-PA 1..227 1..227 1150 95.2 Plus
Dere\GG13428-PA 411 GG13428-PA 218..357 47..185 242 39.7 Plus
Dere\GG23159-PA 486 GG23159-PA 157..279 67..191 232 40.5 Plus
Dere\GG25359-PA 499 GG25359-PA 370..499 51..181 205 36.6 Plus
Dere\GG13761-PA 443 GG13761-PA 50..140 92..182 186 40.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:50:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18398-PA 244 GH18398-PA 50..244 33..227 881 82.1 Plus
Dgri\GH25313-PA 496 GH25313-PA 338..496 21..183 232 36.6 Plus
Dgri\GH16949-PA 425 GH16949-PA 232..370 47..185 231 39.4 Plus
Dgri\GH18324-PA 487 GH18324-PA 117..246 67..198 231 39.7 Plus
Dgri\GH12630-PA 385 GH12630-PA 61..200 46..185 229 39.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:18:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG15528-PB 227 CG15528-PB 1..227 1..227 1159 100 Plus
Mkp3-PA 241 CG14080-PA 48..187 47..185 236 39.7 Plus
Mkp3-PD 411 CG14080-PD 218..357 47..185 236 39.7 Plus
Mkp3-PB 411 CG14080-PB 218..357 47..185 236 39.7 Plus
Mkp3-PC 497 CG14080-PC 218..357 47..185 236 39.7 Plus
puc-PB 369 CG7850-PB 48..170 67..191 234 40.5 Plus
puc-PA 476 CG7850-PA 155..277 67..191 234 40.5 Plus
Mkp-PC 203 CG34099-PC 89..201 66..179 196 37.4 Plus
Mkp-PD 203 CG34099-PD 89..201 66..179 196 37.4 Plus
Mkp-PB 203 CG34099-PB 89..201 66..179 196 37.4 Plus
Mkp-PA 203 CG34099-PA 89..201 66..179 196 37.4 Plus
CG10089-PC 327 CG10089-PC 24..140 62..182 184 34.7 Plus
CG10089-PA 327 CG10089-PA 24..140 62..182 184 34.7 Plus
CG10089-PB 327 CG10089-PB 24..140 62..182 184 34.7 Plus
CG10089-PF 447 CG10089-PF 24..140 62..182 184 34.7 Plus
CG10089-PE 447 CG10089-PE 24..140 62..182 184 34.7 Plus
CG10089-PD 447 CG10089-PD 24..140 62..182 184 34.7 Plus
ssh-PD 1045 CG6238-PD 405..522 64..184 167 33.1 Plus
ssh-PC 1046 CG6238-PC 406..523 64..184 167 33.1 Plus
ssh-PA 1192 CG6238-PA 405..522 64..184 167 33.1 Plus
ssh-PB 1193 CG6238-PB 406..523 64..184 167 33.1 Plus
CG7378-PA 206 CG7378-PA 64..199 56..185 165 34.3 Plus
CG7378-PB 226 CG7378-PB 84..219 56..185 165 34.3 Plus
CG7378-PC 235 CG7378-PC 136..228 92..185 159 38.3 Plus
MKP-4-PC 387 CG14211-PC 91..178 95..182 154 36.4 Plus
MKP-4-PB 387 CG14211-PB 91..178 95..182 154 36.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:50:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23389-PA 246 GI23389-PA 31..246 10..227 891 76.6 Plus
Dmoj\GI11809-PA 419 GI11809-PA 244..364 64..185 222 41 Plus
Dmoj\GI24889-PA 499 GI24889-PA 344..496 24..180 211 34.2 Plus
Dmoj\GI23305-PA 455 GI23305-PA 110..215 67..174 201 39.4 Plus
Dmoj\GI11369-PA 333 GI11369-PA 4..140 43..182 192 33.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:50:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13480-PA 237 GL13480-PA 1..237 1..227 942 77 Plus
Dper\GL24256-PA 489 GL24256-PA 136..278 45..191 243 40.9 Plus
Dper\GL16086-PA 504 GL16086-PA 349..500 24..179 221 36.3 Plus
Dper\GL21927-PA 410 GL21927-PA 236..360 64..189 213 39.1 Plus
Dper\GL20791-PA 305 GL20791-PA 24..140 62..182 188 34.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:50:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13785-PA 237 GA13785-PA 1..237 1..227 936 76.6 Plus
Dpse\GA20632-PA 489 GA20632-PA 156..278 67..191 239 42.1 Plus
Dpse\GA20054-PA 504 GA20054-PA 349..500 24..179 220 36.3 Plus
Dpse\GA12750-PA 410 GA12750-PA 236..360 64..189 213 39.1 Plus
Dpse\GA10063-PA 598 GA10063-PA 4..140 43..182 190 32.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:50:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12185-PA 212 GM12185-PA 11..212 26..227 1037 97 Plus
Dsec\GM14895-PA 411 GM14895-PA 218..357 47..185 244 39.7 Plus
Dsec\GM23703-PA 478 GM23703-PA 155..277 67..191 232 40.5 Plus
Dsec\GM14299-PA 499 GM14299-PA 370..497 51..179 216 37.7 Plus
Dsec\GM24587-PA 440 GM24587-PA 50..140 92..182 186 40.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:50:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17377-PA 233 GD17377-PA 1..233 1..227 1166 95.7 Plus
Dsim\GD12305-PA 411 GD12305-PA 218..357 47..185 244 39.7 Plus
Dsim\GD18513-PA 482 GD18513-PA 155..277 67..191 232 40.5 Plus
Dsim\GD13536-PA 499 GD13536-PA 370..496 51..178 211 37.2 Plus
Dsim\GD12655-PA 443 GD12655-PA 50..140 92..182 186 40.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:50:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10384-PA 247 GJ10384-PA 32..247 11..227 873 74.9 Plus
Dvir\GJ13512-PA 417 GJ13512-PA 224..362 47..185 235 40 Plus
Dvir\GJ24161-PA 513 GJ24161-PA 155..277 67..191 230 40.5 Plus
Dvir\GJ12898-PA 513 GJ12898-PA 358..512 24..182 229 35 Plus
Dvir\GJ11624-PA 465 GJ11624-PA 26..140 64..182 186 36.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:50:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13421-PA 257 GK13421-PA 50..257 20..227 891 76.9 Plus
Dwil\GK12504-PA 432 GK12504-PA 238..379 47..187 236 39.3 Plus
Dwil\GK14377-PA 529 GK14377-PA 149..276 67..196 217 38.2 Plus
Dwil\GK25867-PA 508 GK12492-PA 336..505 19..189 199 34.1 Plus
Dwil\GK17106-PA 458 GK17106-PA 26..140 64..182 184 35.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:50:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23417-PA 200 GE23417-PA 2..200 29..227 1019 96.5 Plus
Dyak\GE22784-PA 279 GE22784-PA 86..225 47..185 244 39.7 Plus
Dyak\GE22525-PA 411 GE22525-PA 218..357 47..185 242 39.7 Plus
Dyak\GE25849-PA 479 GE25849-PA 155..277 67..191 231 40.5 Plus
Dyak\GE26463-PA 495 GE21044-PA 366..493 51..179 207 36.9 Plus

IP21249.hyp Sequence

Translation from 174 to 857

> IP21249.hyp
MQELIVGGIAISGVPFANETVEKESRQNQLSASTLEDHTPFPGLSRITPS
LILCGAAAVVPAYMDKLGVSCVINVAPELPDTPLPSQKNPLYLRIMAQDR
SEVDLAKHFDEAADLIEEVHLSGGCTLIHCVAGVSRSASLCLAYLMKHAG
MSLREAYKHVQAIRPQVRPNSGFFQQLRRYEQQLRGSSSVAMVYFASLDK
EIPDILEPEYRAMEDFYQRYRSSLKRR*

IP21249.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:18:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG15528-PB 227 CG15528-PB 1..227 1..227 1159 100 Plus
Mkp3-PA 241 CG14080-PA 48..187 47..185 236 39.7 Plus
Mkp3-PD 411 CG14080-PD 218..357 47..185 236 39.7 Plus
Mkp3-PB 411 CG14080-PB 218..357 47..185 236 39.7 Plus
puc-PB 369 CG7850-PB 48..170 67..191 234 40.5 Plus