BDGP Sequence Production Resources |
Search the DGRC for IP21250
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 212 |
Well: | 50 |
Vector: | pOT2 |
Associated Gene/Transcript | CecA1-RA |
Protein status: | IP21250.pep: gold |
Sequenced Size: | 348 |
Gene | Date | Evidence |
---|---|---|
CecA2 | 2008-05-05 | Release 5.5 slip selected |
CecA2 | 2008-08-15 | Release 5.9 accounting |
CecA2 | 2008-12-18 | 5.12 accounting |
348 bp assembled on 2008-05-14
GenBank Submission: BT032790
> IP21250.complete CAACAGCAACATCAGAGCTATAGCTACTCTTGCAAAATCTAAAGTCAAAT AAAACCACCATGAACTTCTACAACATCTTCGTTTTCGTCGCTCTCATTCT GGCCATCACCATTGGACAATCGGAAGCTGGTTGGCTAAAGAAAATTGGCA AGAAAATCGAACGTGTTGGTCAGCACACTCGCGACGCCACAATCCAGGGA CTGGGAATCGCTCAACAGGCCGCCAATGTTGCAGCCACTGCTCGAGGTTA ACCACGATGACTATCTAATAAATATTTATACAAAATCTTATTTATTTTTT TTGATCTAAGTAAATAAAACATTGGGAAAATCAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 26034860..26035033 | 159..332 | 825 | 98.3 | Plus |
chr3R | 27901430 | chr3R | 26034644..26034802 | 1..159 | 705 | 96.2 | Plus |
chr3R | 27901430 | chr3R | 26033409..26033512 | 56..159 | 475 | 97.1 | Plus |
chr3R | 27901430 | chr3R | 26039041..26039144 | 56..159 | 385 | 91.3 | Plus |
chr3R | 27901430 | chr3R | 26033573..26033678 | 159..264 | 380 | 90.6 | Plus |
chr3R | 27901430 | chr3R | 26035948..26036038 | 249..159 | 230 | 83.5 | Minus |
chr3R | 27901430 | chr3R | 26036096..26036196 | 159..59 | 220 | 81.2 | Minus |
chr3R | 27901430 | chr3R | 26039220..26039292 | 166..238 | 215 | 86.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 30212395..30212570 | 159..334 | 880 | 100 | Plus |
3R | 32079331 | 3R | 30212179..30212337 | 1..159 | 795 | 100 | Plus |
3R | 32079331 | 3R | 30210944..30211047 | 56..159 | 490 | 98.1 | Plus |
3R | 32079331 | 3R | 30216573..30216676 | 56..159 | 400 | 92.3 | Plus |
3R | 32079331 | 3R | 30211108..30211213 | 159..264 | 380 | 90.6 | Plus |
3R | 32079331 | 3R | 30213478..30213568 | 249..159 | 260 | 85.7 | Minus |
3R | 32079331 | 3R | 30216752..30216824 | 166..238 | 200 | 84.9 | Plus |
3R | 32079331 | 3R | 30213626..30213726 | 159..59 | 190 | 79.2 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 29953226..29953401 | 159..334 | 880 | 100 | Plus |
3R | 31820162 | 3R | 29953010..29953168 | 1..159 | 795 | 100 | Plus |
3R | 31820162 | 3R | 29951775..29951878 | 56..159 | 490 | 98 | Plus |
3R | 31820162 | 3R | 29957404..29957507 | 56..159 | 400 | 92.3 | Plus |
3R | 31820162 | 3R | 29951939..29952058 | 159..279 | 385 | 89.2 | Plus |
3R | 31820162 | 3R | 29954309..29954399 | 249..159 | 260 | 85.7 | Minus |
3R | 31820162 | 3R | 29957583..29957655 | 166..238 | 200 | 84.9 | Plus |
3R | 31820162 | 3R | 29954457..29954557 | 159..59 | 190 | 79.2 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 26034644..26034801 | 1..158 | 96 | -> | Plus |
chr3R | 26034860..26035033 | 159..332 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CecA2-RA | 1..192 | 60..251 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CecA2-RA | 1..192 | 60..251 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CecA2-RA | 1..192 | 60..251 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CecA2-RA | 1..192 | 60..251 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CecA2-RA | 1..192 | 60..251 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CecA2-RA | 24..355 | 1..332 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CecA2-RA | 24..355 | 1..332 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CecA2-RA | 24..355 | 1..332 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CecA2-RA | 24..355 | 1..332 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CecA2-RA | 24..355 | 1..332 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 30212179..30212336 | 1..158 | 100 | -> | Plus |
3R | 30212395..30212568 | 159..332 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 30212179..30212336 | 1..158 | 100 | -> | Plus |
3R | 30212395..30212568 | 159..332 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 30212179..30212336 | 1..158 | 100 | -> | Plus |
3R | 30212395..30212568 | 159..332 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 26037901..26038058 | 1..158 | 100 | -> | Plus |
arm_3R | 26038117..26038290 | 159..332 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 29953010..29953167 | 1..158 | 100 | -> | Plus |
3R | 29953226..29953399 | 159..332 | 100 | Plus |
Translation from 59 to 250
> IP21250.hyp MNFYNIFVFVALILAITIGQSEAGWLKKIGKKIERVGQHTRDATIQGLGI AQQAANVAATARG*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CecA2-PA | 63 | CG1367-PA | 1..63 | 1..63 | 313 | 100 | Plus |
CecA1-PA | 63 | CG1365-PA | 1..63 | 1..63 | 313 | 100 | Plus |
CecC-PA | 63 | CG1373-PA | 1..63 | 1..63 | 297 | 92.1 | Plus |
CecB-PA | 63 | CG1878-PA | 1..63 | 1..63 | 268 | 84.1 | Plus |
Translation from 59 to 250
> IP21250.pep MNFYNIFVFVALILAITIGQSEAGWLKKIGKKIERVGQHTRDATIQGLGI AQQAANVAATARG*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF18827-PA | 63 | GF18827-PA | 1..63 | 1..63 | 302 | 93.7 | Plus |
Dana\GF18829-PA | 63 | GF18829-PA | 1..63 | 1..63 | 279 | 88.9 | Plus |
Dana\GF16190-PA | 63 | GF16190-PA | 1..63 | 1..63 | 217 | 82.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG26130-PA | 63 | GG11740-PA | 1..63 | 1..63 | 303 | 95.2 | Plus |
Dere\GG11739-PA | 63 | GG11739-PA | 1..63 | 1..63 | 303 | 95.2 | Plus |
Dere\GG11950-PA | 63 | GG11950-PA | 1..63 | 1..63 | 275 | 85.7 | Plus |
Dere\GG11742-PA | 66 | GG11742-PA | 1..63 | 1..63 | 155 | 46 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH19152-PA | 63 | GH19152-PA | 1..63 | 1..63 | 300 | 92.1 | Plus |
Dgri\GH19151-PA | 63 | GH19151-PA | 1..63 | 1..63 | 300 | 92.1 | Plus |
Dgri\GH18419-PA | 63 | GH18419-PA | 1..63 | 1..63 | 300 | 92.1 | Plus |
Dgri\GH23329-PA | 63 | GH23329-PA | 1..63 | 1..63 | 298 | 90.5 | Plus |
Dgri\GH23207-PA | 63 | GH23207-PA | 1..63 | 1..63 | 296 | 88.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CecA1-PA | 63 | CG1365-PA | 1..63 | 1..63 | 313 | 100 | Plus |
CecA2-PA | 63 | CG1367-PA | 1..63 | 1..63 | 313 | 100 | Plus |
CecC-PA | 63 | CG1373-PA | 1..63 | 1..63 | 297 | 92.1 | Plus |
CecB-PA | 63 | CG1878-PA | 1..63 | 1..63 | 268 | 84.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI23259-PA | 186 | GI23259-PA | 124..186 | 1..63 | 304 | 93.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\CecIV-PA | 63 | GA15079-PA | 1..63 | 1..63 | 285 | 85.7 | Plus |
Dpse\CecIII-PA | 63 | GA12447-PA | 1..63 | 1..63 | 285 | 85.7 | Plus |
Dpse\CecV-PA | 63 | GA26855-PA | 1..63 | 1..63 | 285 | 85.7 | Plus |
Dpse\CecII-PA | 63 | GA17203-PA | 1..63 | 1..63 | 271 | 81 | Plus |
Dpse\CecI-PA | 63 | GA12435-PA | 1..63 | 1..63 | 241 | 92.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\CecA1-PA | 63 | GM12870-PA | 1..63 | 1..63 | 314 | 98.4 | Plus |
Dsec\CecC-PA | 63 | GM12871-PA | 1..63 | 1..63 | 300 | 92.1 | Plus |
Dsec\CecB-PA | 63 | GM12165-PA | 1..63 | 1..63 | 269 | 82.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\CecA1-PA | 63 | GD21508-PA | 1..63 | 1..63 | 314 | 98.4 | Plus |
Dsim\CecC-PA | 63 | GD21509-PA | 1..63 | 1..63 | 300 | 92.1 | Plus |
Dsim\CecB-PA | 63 | GD17190-PA | 1..63 | 1..63 | 269 | 82.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\Cec2A-PA | 63 | GJ10757-PA | 1..63 | 1..63 | 302 | 92.1 | Plus |
Dvir\Cec2B-PA | 63 | GJ10406-PA | 1..63 | 1..63 | 302 | 92.1 | Plus |
Dvir\Cec1-PA | 63 | GJ10758-PA | 1..63 | 1..63 | 300 | 90.5 | Plus |
Dvir\Cec3-PA | 63 | GJ10755-PA | 1..63 | 1..63 | 300 | 90.5 | Plus |
Dvir\GJ10759-PA | 63 | GJ10759-PA | 1..63 | 1..63 | 217 | 63.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK14120-PA | 63 | GK14120-PA | 1..63 | 1..63 | 303 | 93.7 | Plus |
Dwil\GK14123-PA | 63 | GK14123-PA | 1..63 | 1..63 | 302 | 92.1 | Plus |
Dwil\GK14124-PA | 63 | GK14124-PA | 1..63 | 1..63 | 299 | 92.1 | Plus |
Dwil\GK14122-PA | 63 | GK14122-PA | 1..63 | 1..63 | 288 | 87.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE10867-PA | 63 | GE10867-PA | 1..63 | 1..63 | 309 | 98.4 | Plus |
Dyak\GE10866-PA | 63 | GE10866-PA | 1..63 | 1..63 | 299 | 95.2 | Plus |
Dyak\GE23398-PA | 63 | GE23398-PA | 1..63 | 1..63 | 276 | 85.7 | Plus |
Dyak\GE10868-PA | 64 | GE10868-PA | 1..60 | 1..54 | 133 | 52.5 | Plus |