Clone IP21250 Report

Search the DGRC for IP21250

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:212
Well:50
Vector:pOT2
Associated Gene/TranscriptCecA1-RA
Protein status:IP21250.pep: gold
Sequenced Size:348

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CecA2 2008-05-05 Release 5.5 slip selected
CecA2 2008-08-15 Release 5.9 accounting
CecA2 2008-12-18 5.12 accounting

Clone Sequence Records

IP21250.complete Sequence

348 bp assembled on 2008-05-14

GenBank Submission: BT032790

> IP21250.complete
CAACAGCAACATCAGAGCTATAGCTACTCTTGCAAAATCTAAAGTCAAAT
AAAACCACCATGAACTTCTACAACATCTTCGTTTTCGTCGCTCTCATTCT
GGCCATCACCATTGGACAATCGGAAGCTGGTTGGCTAAAGAAAATTGGCA
AGAAAATCGAACGTGTTGGTCAGCACACTCGCGACGCCACAATCCAGGGA
CTGGGAATCGCTCAACAGGCCGCCAATGTTGCAGCCACTGCTCGAGGTTA
ACCACGATGACTATCTAATAAATATTTATACAAAATCTTATTTATTTTTT
TTGATCTAAGTAAATAAAACATTGGGAAAATCAAAAAAAAAAAAAAAA

IP21250.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:58:32
Subject Length Description Subject Range Query Range Score Percent Strand
CecA2-RA 480 CecA2-RA 24..357 1..334 1670 100 Plus
CecA1-RA 474 CecA1-RA 188..410 56..279 870 93.3 Plus
CecC-RA 485 CecC-RA 146..328 56..238 585 87.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:11:08
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 26034860..26035033 159..332 825 98.3 Plus
chr3R 27901430 chr3R 26034644..26034802 1..159 705 96.2 Plus
chr3R 27901430 chr3R 26033409..26033512 56..159 475 97.1 Plus
chr3R 27901430 chr3R 26039041..26039144 56..159 385 91.3 Plus
chr3R 27901430 chr3R 26033573..26033678 159..264 380 90.6 Plus
chr3R 27901430 chr3R 26035948..26036038 249..159 230 83.5 Minus
chr3R 27901430 chr3R 26036096..26036196 159..59 220 81.2 Minus
chr3R 27901430 chr3R 26039220..26039292 166..238 215 86.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:45:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:11:06
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30212395..30212570 159..334 880 100 Plus
3R 32079331 3R 30212179..30212337 1..159 795 100 Plus
3R 32079331 3R 30210944..30211047 56..159 490 98.1 Plus
3R 32079331 3R 30216573..30216676 56..159 400 92.3 Plus
3R 32079331 3R 30211108..30211213 159..264 380 90.6 Plus
3R 32079331 3R 30213478..30213568 249..159 260 85.7 Minus
3R 32079331 3R 30216752..30216824 166..238 200 84.9 Plus
3R 32079331 3R 30213626..30213726 159..59 190 79.2 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:53:44
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 29953226..29953401 159..334 880 100 Plus
3R 31820162 3R 29953010..29953168 1..159 795 100 Plus
3R 31820162 3R 29951775..29951878 56..159 490 98 Plus
3R 31820162 3R 29957404..29957507 56..159 400 92.3 Plus
3R 31820162 3R 29951939..29952058 159..279 385 89.2 Plus
3R 31820162 3R 29954309..29954399 249..159 260 85.7 Minus
3R 31820162 3R 29957583..29957655 166..238 200 84.9 Plus
3R 31820162 3R 29954457..29954557 159..59 190 79.2 Minus
Blast to na_te.dros performed on 2019-03-16 00:11:06 has no hits.

IP21250.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:11:52 Download gff for IP21250.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 26034644..26034801 1..158 96 -> Plus
chr3R 26034860..26035033 159..332 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:24:28 Download gff for IP21250.complete
Subject Subject Range Query Range Percent Splice Strand
CecA2-RA 1..192 60..251 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:50:22 Download gff for IP21250.complete
Subject Subject Range Query Range Percent Splice Strand
CecA2-RA 1..192 60..251 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:48:48 Download gff for IP21250.complete
Subject Subject Range Query Range Percent Splice Strand
CecA2-RA 1..192 60..251 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:52:04 Download gff for IP21250.complete
Subject Subject Range Query Range Percent Splice Strand
CecA2-RA 1..192 60..251 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 02:00:29 Download gff for IP21250.complete
Subject Subject Range Query Range Percent Splice Strand
CecA2-RA 1..192 60..251 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:15:50 Download gff for IP21250.complete
Subject Subject Range Query Range Percent Splice Strand
CecA2-RA 24..355 1..332 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:50:22 Download gff for IP21250.complete
Subject Subject Range Query Range Percent Splice Strand
CecA2-RA 24..355 1..332 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:48:48 Download gff for IP21250.complete
Subject Subject Range Query Range Percent Splice Strand
CecA2-RA 24..355 1..332 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:52:04 Download gff for IP21250.complete
Subject Subject Range Query Range Percent Splice Strand
CecA2-RA 24..355 1..332 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:00:29 Download gff for IP21250.complete
Subject Subject Range Query Range Percent Splice Strand
CecA2-RA 24..355 1..332 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:11:52 Download gff for IP21250.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30212179..30212336 1..158 100 -> Plus
3R 30212395..30212568 159..332 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:11:52 Download gff for IP21250.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30212179..30212336 1..158 100 -> Plus
3R 30212395..30212568 159..332 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:11:52 Download gff for IP21250.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30212179..30212336 1..158 100 -> Plus
3R 30212395..30212568 159..332 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:48:48 Download gff for IP21250.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 26037901..26038058 1..158 100 -> Plus
arm_3R 26038117..26038290 159..332 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:28:58 Download gff for IP21250.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29953010..29953167 1..158 100 -> Plus
3R 29953226..29953399 159..332 100   Plus

IP21250.hyp Sequence

Translation from 59 to 250

> IP21250.hyp
MNFYNIFVFVALILAITIGQSEAGWLKKIGKKIERVGQHTRDATIQGLGI
AQQAANVAATARG*

IP21250.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:19:03
Subject Length Description Subject Range Query Range Score Percent Strand
CecA2-PA 63 CG1367-PA 1..63 1..63 313 100 Plus
CecA1-PA 63 CG1365-PA 1..63 1..63 313 100 Plus
CecC-PA 63 CG1373-PA 1..63 1..63 297 92.1 Plus
CecB-PA 63 CG1878-PA 1..63 1..63 268 84.1 Plus

IP21250.pep Sequence

Translation from 59 to 250

> IP21250.pep
MNFYNIFVFVALILAITIGQSEAGWLKKIGKKIERVGQHTRDATIQGLGI
AQQAANVAATARG*

IP21250.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:30:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18827-PA 63 GF18827-PA 1..63 1..63 302 93.7 Plus
Dana\GF18829-PA 63 GF18829-PA 1..63 1..63 279 88.9 Plus
Dana\GF16190-PA 63 GF16190-PA 1..63 1..63 217 82.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:30:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG26130-PA 63 GG11740-PA 1..63 1..63 303 95.2 Plus
Dere\GG11739-PA 63 GG11739-PA 1..63 1..63 303 95.2 Plus
Dere\GG11950-PA 63 GG11950-PA 1..63 1..63 275 85.7 Plus
Dere\GG11742-PA 66 GG11742-PA 1..63 1..63 155 46 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:30:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19152-PA 63 GH19152-PA 1..63 1..63 300 92.1 Plus
Dgri\GH19151-PA 63 GH19151-PA 1..63 1..63 300 92.1 Plus
Dgri\GH18419-PA 63 GH18419-PA 1..63 1..63 300 92.1 Plus
Dgri\GH23329-PA 63 GH23329-PA 1..63 1..63 298 90.5 Plus
Dgri\GH23207-PA 63 GH23207-PA 1..63 1..63 296 88.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:16:45
Subject Length Description Subject Range Query Range Score Percent Strand
CecA1-PA 63 CG1365-PA 1..63 1..63 313 100 Plus
CecA2-PA 63 CG1367-PA 1..63 1..63 313 100 Plus
CecC-PA 63 CG1373-PA 1..63 1..63 297 92.1 Plus
CecB-PA 63 CG1878-PA 1..63 1..63 268 84.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:30:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23259-PA 186 GI23259-PA 124..186 1..63 304 93.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:30:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\CecIV-PA 63 GA15079-PA 1..63 1..63 285 85.7 Plus
Dpse\CecIII-PA 63 GA12447-PA 1..63 1..63 285 85.7 Plus
Dpse\CecV-PA 63 GA26855-PA 1..63 1..63 285 85.7 Plus
Dpse\CecII-PA 63 GA17203-PA 1..63 1..63 271 81 Plus
Dpse\CecI-PA 63 GA12435-PA 1..63 1..63 241 92.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:30:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\CecA1-PA 63 GM12870-PA 1..63 1..63 314 98.4 Plus
Dsec\CecC-PA 63 GM12871-PA 1..63 1..63 300 92.1 Plus
Dsec\CecB-PA 63 GM12165-PA 1..63 1..63 269 82.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:30:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\CecA1-PA 63 GD21508-PA 1..63 1..63 314 98.4 Plus
Dsim\CecC-PA 63 GD21509-PA 1..63 1..63 300 92.1 Plus
Dsim\CecB-PA 63 GD17190-PA 1..63 1..63 269 82.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:30:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Cec2A-PA 63 GJ10757-PA 1..63 1..63 302 92.1 Plus
Dvir\Cec2B-PA 63 GJ10406-PA 1..63 1..63 302 92.1 Plus
Dvir\Cec1-PA 63 GJ10758-PA 1..63 1..63 300 90.5 Plus
Dvir\Cec3-PA 63 GJ10755-PA 1..63 1..63 300 90.5 Plus
Dvir\GJ10759-PA 63 GJ10759-PA 1..63 1..63 217 63.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:30:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14120-PA 63 GK14120-PA 1..63 1..63 303 93.7 Plus
Dwil\GK14123-PA 63 GK14123-PA 1..63 1..63 302 92.1 Plus
Dwil\GK14124-PA 63 GK14124-PA 1..63 1..63 299 92.1 Plus
Dwil\GK14122-PA 63 GK14122-PA 1..63 1..63 288 87.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:30:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10867-PA 63 GE10867-PA 1..63 1..63 309 98.4 Plus
Dyak\GE10866-PA 63 GE10866-PA 1..63 1..63 299 95.2 Plus
Dyak\GE23398-PA 63 GE23398-PA 1..63 1..63 276 85.7 Plus
Dyak\GE10868-PA 64 GE10868-PA 1..60 1..54 133 52.5 Plus