Clone IP21259 Report

Search the DGRC for IP21259

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:212
Well:59
Vector:pOT2
Protein status:IP21259.pep: Imported from assembly
Sequenced Size:955

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3598 2008-05-05 Release 5.5 slip selected
CG3598 2008-08-15 Release 5.9 accounting
CG3598 2008-12-18 5.12 accounting

Clone Sequence Records

IP21259.complete Sequence

955 bp assembled on 2008-05-22

GenBank Submission: BT032791

> IP21259.complete
CTGGGTGCTATCTTGTTGGTGGGCTTGTGCCTGTTTGTGGCCGTGGCCTT
GGCCGAGCCACGCCTTCAGCACGTTCAGGGGCGCAATCAGGTGCAGGGTC
AAAGGGCGCAGCAGCATCCCTACCTCTTCCTGTCAATTCCCAAGGGTCGG
GCCAACGCCGGCGCCGTCGTCCAGGGCTTCGAAATTGTCGAGGAGGAAGA
TGATGATCTACATGATGAGGACCAGCACGATGACGAGACGGAGGATGACG
AGGAACTGGAGCATCAGCTGGGCCTGAACTTTGCCCGCAGCGGTCTGGCT
TACAGGCAGAACCACGCTGATGACGAACAGGACGATGATCAGGATCAGGA
GCAGGATCACGTTCAGGATGAGCTGCCCAAGAAGCAGATGATGGTTAACC
GGGATCAGGCTGGTGCCATTATGGTGCCCGATGGCATTATCGAGATCGAG
GGTCAGAGTGTTCTGGACGAGAAGACCGGCAAGGCGGCTCTCCTAGTGCC
TCGTGCCGCCCTAGACGCCATTCCCGATGGCGCGGTGGTGGCTCTTATGG
AGCGATCCGCCTCATCCGTTGATGAAATCGAGGAAGAGCGCGCCAACCGC
GTGGTAGTTCGTCGCCGCAAGAACAACGGACGCAGGAACATTCGCCGCCG
CGGCATCAACAACAACAATATCCGACGCCGCCGCCCCGCCCAAAGGCGTC
GCCGAGTGGGTGGCAACCGCAGGCGCAATGTACGCGTCATTCGCCCCCAA
GGCGGCAACCGTAGGCGTGGCAACCAGAGGCGCCGCGGACAGGTCGTATT
CCAGGGTTGAGACACGAAACGAAGGTCGTCCTAGCCCCATTTCTATATAG
TATTATAGTTAAGATCCCCTAACGATCAGGACAAGAAATTTGAGACACTT
GATGACGATGCGACAAATAAAATGTGATATGAAAATTAAAAAAAAAAAAA
AAAAA

IP21259.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:51:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG3598-RA 946 CG3598-RA 10..946 1..937 4685 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-17 00:16:12
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 2830925..2831861 1..937 4550 99 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:45:01 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-17 00:16:10
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 2937137..2938078 1..942 4695 99.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:48:32
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 2945235..2946176 1..942 4695 99.8 Plus
Blast to na_te.dros performed 2019-03-17 00:16:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 3279..3352 624..697 118 62.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2382..2442 615..678 115 67.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2376..2431 615..670 109 66.1 Plus

IP21259.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-17 00:17:02 Download gff for IP21259.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 2830925..2831855 1..931 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:24:31 Download gff for IP21259.complete
Subject Subject Range Query Range Percent Splice Strand
CG3598-RA 10..819 1..810 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:38:07 Download gff for IP21259.complete
Subject Subject Range Query Range Percent Splice Strand
CG3598-RA 10..819 1..810 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:36:02 Download gff for IP21259.complete
Subject Subject Range Query Range Percent Splice Strand
CG3598-RA 10..819 1..810 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:43:50 Download gff for IP21259.complete
Subject Subject Range Query Range Percent Splice Strand
CG3598-RA 10..819 1..810 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:18:08 Download gff for IP21259.complete
Subject Subject Range Query Range Percent Splice Strand
CG3598-RA 10..819 1..810 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:07:17 Download gff for IP21259.complete
Subject Subject Range Query Range Percent Splice Strand
CG3598-RA 10..819 1..810 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:38:06 Download gff for IP21259.complete
Subject Subject Range Query Range Percent Splice Strand
CG3598-RA 10..946 1..937 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:36:02 Download gff for IP21259.complete
Subject Subject Range Query Range Percent Splice Strand
CG3598-RA 111..1047 1..937 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:43:50 Download gff for IP21259.complete
Subject Subject Range Query Range Percent Splice Strand
CG3598-RA 10..819 1..810 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:18:08 Download gff for IP21259.complete
Subject Subject Range Query Range Percent Splice Strand
CG3598-RA 111..1047 1..937 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:17:02 Download gff for IP21259.complete
Subject Subject Range Query Range Percent Splice Strand
X 2937137..2938073 1..937 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:17:02 Download gff for IP21259.complete
Subject Subject Range Query Range Percent Splice Strand
X 2937137..2938073 1..937 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:17:02 Download gff for IP21259.complete
Subject Subject Range Query Range Percent Splice Strand
X 2937137..2938073 1..937 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:36:02 Download gff for IP21259.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 2831170..2832106 1..937 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:20:50 Download gff for IP21259.complete
Subject Subject Range Query Range Percent Splice Strand
X 2945235..2946171 1..937 100   Plus

IP21259.pep Sequence

Translation from 0 to 809

> IP21259.pep
LGAILLVGLCLFVAVALAEPRLQHVQGRNQVQGQRAQQHPYLFLSIPKGR
ANAGAVVQGFEIVEEEDDDLHDEDQHDDETEDDEELEHQLGLNFARSGLA
YRQNHADDEQDDDQDQEQDHVQDELPKKQMMVNRDQAGAIMVPDGIIEIE
GQSVLDEKTGKAALLVPRAALDAIPDGAVVALMERSASSVDEIEEERANR
VVVRRRKNNGRRNIRRRGINNNNIRRRRPAQRRRRVGGNRRRNVRVIRPQ
GGNRRRGNQRRRGQVVFQG*

IP21259.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:55:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22462-PA 299 GF22462-PA 4..253 1..220 582 60.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:55:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18636-PA 278 GG18636-PA 4..203 1..196 744 90 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:55:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12478-PA 336 GH12478-PA 193..282 128..215 359 83.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:17:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG3598-PA 272 CG3598-PA 4..272 1..269 1374 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:55:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11159-PA 311 GI11159-PA 177..256 128..207 344 86.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:55:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19935-PA 328 GL19935-PA 45..254 40..196 380 50.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:55:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28481-PA 326 GA28481-PA 43..252 40..196 382 50.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:55:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19255-PA 273 GM19255-PA 4..273 1..269 1303 95.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:55:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16625-PA 286 GD16625-PA 4..212 1..209 1036 96.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:55:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15291-PA 321 GJ15291-PA 37..260 38..208 411 49.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:55:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25530-PA 321 GK25530-PA 173..256 128..208 329 83.5 Plus

IP21259.hyp Sequence

Translation from 0 to 809

> IP21259.hyp
LGAILLVGLCLFVAVALAEPRLQHVQGRNQVQGQRAQQHPYLFLSIPKGR
ANAGAVVQGFEIVEEEDDDLHDEDQHDDETEDDEELEHQLGLNFARSGLA
YRQNHADDEQDDDQDQEQDHVQDELPKKQMMVNRDQAGAIMVPDGIIEIE
GQSVLDEKTGKAALLVPRAALDAIPDGAVVALMERSASSVDEIEEERANR
VVVRRRKNNGRRNIRRRGINNNNIRRRRPAQRRRRVGGNRRRNVRVIRPQ
GGNRRRGNQRRRGQVVFQG*

IP21259.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:19:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG3598-PA 272 CG3598-PA 4..272 1..269 1374 100 Plus