BDGP Sequence Production Resources |
Search the DGRC for IP21274
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 212 |
Well: | 74 |
Vector: | pOT2 |
Associated Gene/Transcript | wac-RC |
Protein status: | IP21274.pep: gold |
Sequenced Size: | 635 |
Gene | Date | Evidence |
---|---|---|
CG13879 | 2008-05-05 | Release 5.5 slip selected |
CG13879 | 2008-08-15 | Release 5.9 accounting |
CG13879 | 2008-12-18 | 5.12 accounting |
635 bp assembled on 2008-05-27
GenBank Submission: BT032970
> IP21274.complete ATTAAAAAAAACGCTAGGCATACAACTAATTATTCTTATGATGCAGAGAA CTTGAAGATCCAAGAGGAAGTCAATTCATTGATGCGTCTAGGCCAGCACT TCGATGACCAGTTAAAGCTGGCTAGCGTCGAGTTGGGCGATTTCTCGGAC GATGACCTGGCGCTCCTTGACAAATGCGCCCAATATTATTCACTTTTGCA CATTCACGACATCAATCTGAACTACTTGCGCGACTTCTATTGTGCCAAGA AGAGGGAATGCATAGAAAACCGGCAGACCACAGTGCAGCAACGCGTAGAG CTGCAGCGCATCCTCTCGTCCATCGAGGAGGCTACTAGGGACGTAGTTAT GTTGGAGAGATTTAATGCTGCTGCGGAAGAGCGGCTCATCCCGGATATCG TCGTAATGCAGCGAAACGCCCAACAGCTTGCAACAAAACAGGCCTTACTG GACCGGCAAAAAACCCTTAAGATCCCAAAGGATTTTAGCATTGAAAGTGT CATCGAGAAGGTAGATTCGCTGGAGCAGCGCTAAAGAAGTGAATTGCTTT CGTTTTTAAAAAATTATTTAATTGTATTTACTCAGTAATGCAAAACACTT TACAAAAACATAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 258359..258717 | 1..359 | 99 | -> | Plus |
chr3L | 258777..259028 | 360..611 | 91 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13879-RB | 1..492 | 45..534 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
wac-RB | 1..492 | 45..534 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
wac-RB | 1..492 | 45..534 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13879-RB | 1..492 | 45..534 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
wac-RB | 1..492 | 45..534 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13879-RB | 43..534 | 41..534 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
wac-RC | 1..610 | 2..611 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
wac-RC | 1..610 | 2..611 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13879-RB | 43..534 | 41..534 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
wac-RC | 1..610 | 2..611 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 258404..258763 | 1..359 | 99 | -> | Plus |
3L | 258823..259074 | 360..611 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 258404..258763 | 1..359 | 99 | -> | Plus |
3L | 258823..259074 | 360..611 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 258404..258763 | 1..359 | 99 | -> | Plus |
3L | 258823..259074 | 360..611 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 258404..258763 | 1..359 | 99 | -> | Plus |
arm_3L | 258823..259074 | 360..611 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 258404..258763 | 1..359 | 99 | -> | Plus |
3L | 258823..259074 | 360..611 | 100 | Plus |
Translation from 0 to 533
> IP21274.hyp FKKNARHTTNYSYDAENLKIQEEVNSLMRLGQHFDDQLKLASVELGDFSD DDLALLDKCAQYYSLLHIHDINLNYLRDFYCAKKRECIENRQTTVQQRVE LQRILSSIEEATRDVVMLERFNAAAEERLIPDIVVMQRNAQQLATKQALL DRQKTLKIPKDFSIESVIEKVDSLEQR*
Translation from 0 to 533
> IP21274.pep IKKNARHTTNYSYDAENLKIQEEVNSLMRLGQHFDDQLKLASVELGDFSD DDLALLDKCAQYYSLLHIHDINLNYLRDFYCAKKRECIENRQTTVQQRVE LQRILSSIEEATRDVVMLERFNAAAEERLIPDIVVMQRNAQQLATKQALL DRQKTLKIPKDFSIESVIEKVDSLEQR*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF25041-PA | 163 | GF25041-PA | 3..163 | 17..177 | 527 | 59.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG14708-PA | 163 | GG14708-PA | 2..163 | 16..177 | 751 | 88.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
wac-PD | 163 | CG13879-PD | 2..163 | 16..177 | 805 | 99.4 | Plus |
wac-PB | 163 | CG13879-PB | 2..163 | 16..177 | 805 | 99.4 | Plus |
wac-PC | 150 | CG13879-PC | 1..150 | 28..177 | 751 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI12792-PA | 168 | GI12792-PA | 9..167 | 18..177 | 298 | 43.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL16121-PA | 139 | GL16121-PA | 1..138 | 40..177 | 374 | 52.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12594-PA | 139 | GA12594-PA | 1..138 | 40..177 | 373 | 52.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM14323-PA | 163 | GM14323-PA | 2..163 | 16..177 | 812 | 96.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11004-PA | 148 | GD11004-PA | 1..148 | 30..177 | 723 | 93.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ16091-PA | 145 | GJ16091-PA | 2..140 | 38..176 | 295 | 45.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE21071-PA | 163 | GE21071-PA | 2..163 | 16..177 | 750 | 89.5 | Plus |