Clone IP21274 Report

Search the DGRC for IP21274

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:212
Well:74
Vector:pOT2
Associated Gene/Transcriptwac-RC
Protein status:IP21274.pep: gold
Sequenced Size:635

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13879 2008-05-05 Release 5.5 slip selected
CG13879 2008-08-15 Release 5.9 accounting
CG13879 2008-12-18 5.12 accounting

Clone Sequence Records

IP21274.complete Sequence

635 bp assembled on 2008-05-27

GenBank Submission: BT032970

> IP21274.complete
ATTAAAAAAAACGCTAGGCATACAACTAATTATTCTTATGATGCAGAGAA
CTTGAAGATCCAAGAGGAAGTCAATTCATTGATGCGTCTAGGCCAGCACT
TCGATGACCAGTTAAAGCTGGCTAGCGTCGAGTTGGGCGATTTCTCGGAC
GATGACCTGGCGCTCCTTGACAAATGCGCCCAATATTATTCACTTTTGCA
CATTCACGACATCAATCTGAACTACTTGCGCGACTTCTATTGTGCCAAGA
AGAGGGAATGCATAGAAAACCGGCAGACCACAGTGCAGCAACGCGTAGAG
CTGCAGCGCATCCTCTCGTCCATCGAGGAGGCTACTAGGGACGTAGTTAT
GTTGGAGAGATTTAATGCTGCTGCGGAAGAGCGGCTCATCCCGGATATCG
TCGTAATGCAGCGAAACGCCCAACAGCTTGCAACAAAACAGGCCTTACTG
GACCGGCAAAAAACCCTTAAGATCCCAAAGGATTTTAGCATTGAAAGTGT
CATCGAGAAGGTAGATTCGCTGGAGCAGCGCTAAAGAAGTGAATTGCTTT
CGTTTTTAAAAAATTATTTAATTGTATTTACTCAGTAATGCAAAACACTT
TACAAAAACATAAAAAAAAAAAAAAAAAAAAAAAA

IP21274.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:52:49
Subject Length Description Subject Range Query Range Score Percent Strand
wac-RC 757 wac-RC 1..614 2..615 3055 99.8 Plus
wac-RB 932 wac-RB 221..789 47..615 2830 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:12:57
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 258359..258717 1..359 1765 99.4 Plus
chr3L 24539361 chr3L 258775..259028 358..611 1270 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:45:03 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:12:55
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 258406..258763 2..359 1775 99.7 Plus
3L 28110227 3L 258821..259078 358..615 1290 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:49:24
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 258406..258763 2..359 1775 99.7 Plus
3L 28103327 3L 258821..259078 358..615 1290 100 Plus
Blast to na_te.dros performed on 2019-03-15 15:12:55 has no hits.

IP21274.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:13:54 Download gff for IP21274.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 258359..258717 1..359 99 -> Plus
chr3L 258777..259028 360..611 91   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:24:34 Download gff for IP21274.complete
Subject Subject Range Query Range Percent Splice Strand
CG13879-RB 1..492 45..534 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:40:15 Download gff for IP21274.complete
Subject Subject Range Query Range Percent Splice Strand
wac-RB 1..492 45..534 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:07:23 Download gff for IP21274.complete
Subject Subject Range Query Range Percent Splice Strand
wac-RB 1..492 45..534 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:46:28 Download gff for IP21274.complete
Subject Subject Range Query Range Percent Splice Strand
CG13879-RB 1..492 45..534 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:31:30 Download gff for IP21274.complete
Subject Subject Range Query Range Percent Splice Strand
wac-RB 1..492 45..534 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:10:00 Download gff for IP21274.complete
Subject Subject Range Query Range Percent Splice Strand
CG13879-RB 43..534 41..534 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:40:14 Download gff for IP21274.complete
Subject Subject Range Query Range Percent Splice Strand
wac-RC 1..610 2..611 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:07:23 Download gff for IP21274.complete
Subject Subject Range Query Range Percent Splice Strand
wac-RC 1..610 2..611 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:46:28 Download gff for IP21274.complete
Subject Subject Range Query Range Percent Splice Strand
CG13879-RB 43..534 41..534 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:31:30 Download gff for IP21274.complete
Subject Subject Range Query Range Percent Splice Strand
wac-RC 1..610 2..611 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:13:54 Download gff for IP21274.complete
Subject Subject Range Query Range Percent Splice Strand
3L 258404..258763 1..359 99 -> Plus
3L 258823..259074 360..611 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:13:54 Download gff for IP21274.complete
Subject Subject Range Query Range Percent Splice Strand
3L 258404..258763 1..359 99 -> Plus
3L 258823..259074 360..611 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:13:54 Download gff for IP21274.complete
Subject Subject Range Query Range Percent Splice Strand
3L 258404..258763 1..359 99 -> Plus
3L 258823..259074 360..611 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:07:23 Download gff for IP21274.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 258404..258763 1..359 99 -> Plus
arm_3L 258823..259074 360..611 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:22:14 Download gff for IP21274.complete
Subject Subject Range Query Range Percent Splice Strand
3L 258404..258763 1..359 99 -> Plus
3L 258823..259074 360..611 100   Plus

IP21274.hyp Sequence

Translation from 0 to 533

> IP21274.hyp
FKKNARHTTNYSYDAENLKIQEEVNSLMRLGQHFDDQLKLASVELGDFSD
DDLALLDKCAQYYSLLHIHDINLNYLRDFYCAKKRECIENRQTTVQQRVE
LQRILSSIEEATRDVVMLERFNAAAEERLIPDIVVMQRNAQQLATKQALL
DRQKTLKIPKDFSIESVIEKVDSLEQR*

IP21274.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:19:13
Subject Length Description Subject Range Query Range Score Percent Strand
wac-PD 163 CG13879-PD 2..163 16..177 805 99.4 Plus
wac-PB 163 CG13879-PB 2..163 16..177 805 99.4 Plus
wac-PC 150 CG13879-PC 1..150 28..177 751 100 Plus

IP21274.pep Sequence

Translation from 0 to 533

> IP21274.pep
IKKNARHTTNYSYDAENLKIQEEVNSLMRLGQHFDDQLKLASVELGDFSD
DDLALLDKCAQYYSLLHIHDINLNYLRDFYCAKKRECIENRQTTVQQRVE
LQRILSSIEEATRDVVMLERFNAAAEERLIPDIVVMQRNAQQLATKQALL
DRQKTLKIPKDFSIESVIEKVDSLEQR*

IP21274.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:36:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25041-PA 163 GF25041-PA 3..163 17..177 527 59.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:36:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14708-PA 163 GG14708-PA 2..163 16..177 751 88.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:54:49
Subject Length Description Subject Range Query Range Score Percent Strand
wac-PD 163 CG13879-PD 2..163 16..177 805 99.4 Plus
wac-PB 163 CG13879-PB 2..163 16..177 805 99.4 Plus
wac-PC 150 CG13879-PC 1..150 28..177 751 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:36:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12792-PA 168 GI12792-PA 9..167 18..177 298 43.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:36:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16121-PA 139 GL16121-PA 1..138 40..177 374 52.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:36:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12594-PA 139 GA12594-PA 1..138 40..177 373 52.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:36:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14323-PA 163 GM14323-PA 2..163 16..177 812 96.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:36:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11004-PA 148 GD11004-PA 1..148 30..177 723 93.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:36:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16091-PA 145 GJ16091-PA 2..140 38..176 295 45.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:36:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21071-PA 163 GE21071-PA 2..163 16..177 750 89.5 Plus