Clone IP21319 Report

Search the DGRC for IP21319

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:213
Well:19
Vector:pOT2
Associated Gene/TranscriptCG34116-RA
Protein status:IP21319.pep: gold
Sequenced Size:816

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15881 2008-05-05 Release 5.5 slip selected
CG34116 2008-08-15 Release 5.9 accounting
CG34116 2008-12-18 5.12 accounting

Clone Sequence Records

IP21319.complete Sequence

816 bp assembled on 2008-05-14

GenBank Submission: BT032795

> IP21319.complete
ACAAAACAAAACAAAATAGCAAAATAATTCAAGATGCCGCTAAAATTCGA
TGATATTCACGAGAAAATTGAAACCGGCGTCTACCAATTGGCTGTTAATG
ACAAAAGCACACGGAGCACTGTGTGGCGGGTGTATCGCAAGATCAAGAAG
GACGATGGTAGCTTTCTGGAGCACGTACTGTTCTGCATCGGCTGCAGGAG
CATTATGTCCTTCACCCACAAATCCACAACGAACCTGAGGCGTCACCGGT
GTCACCTGCAGTATCTCAAGAAACAGGCATTCTGCTGCTACAATTCCAAG
GGCGAATCCAACGACAGAAAGGAGGAGACGGACCAGGAGCATCATGAGGA
ACATGATGACCAACAATCCATGTCGGATGAGTTGGAAACAAAACCCTCTC
CTGCCGATGTTGCCGCCTTTGTGGGGGAAGCGGTCAGCGGCGGAGATTCC
ACTGCAGCTTCAGCCCGTATTCCGGACATTCCCGAGATCGCGCTACCACT
CGACGCAAGTGGGGTCGAGGAGTCCAATGTTTATGCACAGACCTGGTCCC
TTGAGTACCGCAAACTCAGCGAGGACCAAAAATTCTATGCCAAAAAAGCT
ATAGACGAAATCTTCGTATTGGGCAGGCTACGACGCCTTACTCTGAATAC
GGTTCCAACGGCGGAGTAGAATAGTTAATCAGGATTAAGTAGGACTTAAT
TTAAGCTAATATACATACTCTGTACATATTGTGTTTAATCTTTAAAGTCG
TATCCCTAAGTCTGGGATATATCGGAATAAACTATTTGATAAATTGAAAA
AAAAAAAAAAAAAAAA

IP21319.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:00:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG15881-RB 1682 CG15881-RB 60..856 797..1 3985 100 Minus
CG34116-RA 796 CG34116-RA 1..796 1..796 3980 100 Plus
CG15881.b 655 CG15881.b 60..139 797..718 400 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:19:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 19794618..19795413 796..1 3950 99.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:45:13 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:19:31
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 19805240..19806036 797..1 3985 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:56:00
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 19798340..19799136 797..1 3985 100 Minus
Blast to na_te.dros performed on 2019-03-16 21:19:31 has no hits.

IP21319.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:20:08 Download gff for IP21319.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 19794618..19795413 1..796 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:24:48 Download gff for IP21319.complete
Subject Subject Range Query Range Percent Splice Strand
CG34116-RA 1..636 34..669 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:55:42 Download gff for IP21319.complete
Subject Subject Range Query Range Percent Splice Strand
CG34116-RA 1..636 34..669 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:54:07 Download gff for IP21319.complete
Subject Subject Range Query Range Percent Splice Strand
CG34116-RA 1..636 34..669 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:54:49 Download gff for IP21319.complete
Subject Subject Range Query Range Percent Splice Strand
CG34116-RA 1..636 34..669 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:16:46 Download gff for IP21319.complete
Subject Subject Range Query Range Percent Splice Strand
CG34116-RA 1..636 34..669 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:19:39 Download gff for IP21319.complete
Subject Subject Range Query Range Percent Splice Strand
CG15881-RB 61..856 1..796 100   Minus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:55:42 Download gff for IP21319.complete
Subject Subject Range Query Range Percent Splice Strand
CG15881-RB 61..856 1..796 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:54:07 Download gff for IP21319.complete
Subject Subject Range Query Range Percent Splice Strand
CG34116-RA 1..796 1..796 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:54:49 Download gff for IP21319.complete
Subject Subject Range Query Range Percent Splice Strand
CG15881-RB 61..856 1..796 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:16:46 Download gff for IP21319.complete
Subject Subject Range Query Range Percent Splice Strand
CG15881-RB 61..856 1..796 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:20:08 Download gff for IP21319.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19805241..19806036 1..796 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:20:08 Download gff for IP21319.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19805241..19806036 1..796 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:20:08 Download gff for IP21319.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19805241..19806036 1..796 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:54:07 Download gff for IP21319.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 19798341..19799136 1..796 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:32:39 Download gff for IP21319.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19798341..19799136 1..796 100   Minus

IP21319.pep Sequence

Translation from 33 to 668

> IP21319.pep
MPLKFDDIHEKIETGVYQLAVNDKSTRSTVWRVYRKIKKDDGSFLEHVLF
CIGCRSIMSFTHKSTTNLRRHRCHLQYLKKQAFCCYNSKGESNDRKEETD
QEHHEEHDDQQSMSDELETKPSPADVAAFVGEAVSGGDSTAASARIPDIP
EIALPLDASGVEESNVYAQTWSLEYRKLSEDQKFYAKKAIDEIFVLGRLR
RLTLNTVPTAE*

IP21319.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:07:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10849-PA 217 GF10849-PA 1..217 1..211 688 62.4 Plus
Dana\GF23587-PA 280 GF23587-PA 19..103 7..93 192 43.7 Plus
Dana\GF23587-PA 280 GF23587-PA 222..275 156..209 149 46.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:07:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13372-PA 213 GG13372-PA 1..213 1..211 1057 93 Plus
Dere\GG15558-PA 299 GG15558-PA 27..100 7..82 187 46.1 Plus
Dere\GG15557-PA 367 GG15557-PA 18..91 7..84 164 39.2 Plus
Dere\GG15558-PA 299 GG15558-PA 232..292 147..207 163 49.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:07:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16915-PA 252 GH16915-PA 1..248 1..208 636 52.8 Plus
Dgri\GH14652-PA 313 GH14652-PA 19..92 7..82 184 44.7 Plus
Dgri\GH14652-PA 313 GH14652-PA 249..306 150..207 170 53.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG34116-PA 211 CG34116-PA 1..211 1..211 1107 100 Plus
CG11560-PA 303 CG11560-PA 27..122 7..123 184 36.8 Plus
CG11560-PB 307 CG11560-PB 27..122 7..123 184 36.8 Plus
CG11560-PA 303 CG11560-PA 195..296 99..207 162 33.9 Plus
CG11560-PB 307 CG11560-PB 199..300 99..207 162 33.9 Plus
ssp-PA 368 CG17153-PA 19..91 8..84 156 39.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:07:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13669-PA 153 GI13669-PA 18..149 104..208 289 50.8 Plus
Dmoj\GI11637-PA 274 GI11637-PA 19..267 7..207 280 30.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:07:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15729-PA 290 GL15729-PA 18..283 7..207 284 31.3 Plus
Dper\GL15680-PA 121 GL15680-PA 22..121 111..211 270 60.4 Plus
Dper\GL15728-PA 391 GL15728-PA 27..97 7..79 171 43.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:07:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23501-PA 123 GA23501-PA 22..123 111..211 257 60 Plus
Dpse\GA23781-PA 290 GA23781-PA 18..91 7..82 189 47.4 Plus
Dpse\GA23780-PA 378 GA23780-PA 23..93 7..79 171 43.8 Plus
Dpse\GA23781-PA 290 GA23781-PA 230..283 154..207 158 51.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:07:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16254-PA 211 GM16254-PA 1..211 1..211 1087 95.7 Plus
Dsec\GM25326-PA 298 GM25326-PA 27..125 7..107 189 37.6 Plus
Dsec\GM25326-PA 298 GM25326-PA 193..291 105..207 167 35 Plus
Dsec\GM25325-PA 368 GM25325-PA 19..91 8..84 163 39.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:07:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12250-PA 211 GD12250-PA 1..211 1..211 1084 95.7 Plus
Dsim\GD14356-PA 298 GD14356-PA 27..100 7..82 187 44.7 Plus
Dsim\GD14356-PA 298 GD14356-PA 231..291 147..207 162 47.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:07:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14005-PA 256 GJ14005-PA 1..253 1..209 655 53.7 Plus
Dvir\GJ11319-PA 281 GJ11319-PA 19..101 7..91 187 42.4 Plus
Dvir\GJ11319-PA 281 GJ11319-PA 223..276 156..209 164 53.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:07:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16703-PA 264 GK16703-PA 1..264 1..211 538 47 Plus
Dwil\GK16966-PA 344 GK16966-PA 19..92 7..82 189 47.4 Plus
Dwil\GK16966-PA 344 GK16966-PA 285..337 155..207 161 52.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:07:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22465-PA 213 GE22465-PA 1..213 1..211 1063 93.4 Plus
Dyak\GE14589-PA 101 GE14589-PA 1..101 113..211 487 94.1 Plus
Dyak\GE21882-PA 305 GE21882-PA 27..100 7..82 190 46.1 Plus
Dyak\GE21882-PA 305 GE21882-PA 238..298 147..207 165 49.2 Plus
Dyak\GE21881-PA 368 GE21881-PA 19..91 8..84 164 41 Plus

IP21319.hyp Sequence

Translation from 33 to 668

> IP21319.hyp
MPLKFDDIHEKIETGVYQLAVNDKSTRSTVWRVYRKIKKDDGSFLEHVLF
CIGCRSIMSFTHKSTTNLRRHRCHLQYLKKQAFCCYNSKGESNDRKEETD
QEHHEEHDDQQSMSDELETKPSPADVAAFVGEAVSGGDSTAASARIPDIP
EIALPLDASGVEESNVYAQTWSLEYRKLSEDQKFYAKKAIDEIFVLGRLR
RLTLNTVPTAE*

IP21319.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:20:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG34116-PA 211 CG34116-PA 1..211 1..211 1107 100 Plus
CG11560-PA 303 CG11560-PA 27..122 7..123 184 36.8 Plus
CG11560-PA 303 CG11560-PA 195..296 99..207 162 33.9 Plus
ssp-PA 368 CG17153-PA 19..91 8..84 156 39.7 Plus