Clone IP21332 Report

Search the DGRC for IP21332

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:213
Well:32
Vector:pOT2
Associated Gene/TranscriptRtnl2-RB
Protein status:IP21332.pep: gold
Sequenced Size:967

Clone Sequence Records

IP21332.complete Sequence

967 bp assembled on 2009-04-28

GenBank Submission: BT082082.1

> IP21332.complete
GAAATATTAGTCAGCTGTGAAAACTTAAAACATTATTTGCTCTGATCTCA
CAACCAGCATCCGAACGTGCTCTAAAGACATTCGAAAATATGAGTACCGA
TACTTTGATAAAGGCTAAGGACTCCAGCCAAATATTTATGGATCTGAAGA
ACCTGTTGTTATGGCGCAATAGCCGAAAGACTTTGATCGTCTTCACGGGC
ATCCTGCTCCTCCTGCTGGATGTGATGGTCCACTCGGTGATCAGTGTGAT
AAGCATGGTAGGGATCACAGTTCTCATAGCAGCTATTGGCCATCGCCTTT
TGGTACAGTTCTGGAGTATCTGGAAGAAGGATGAGAACAAAGATCAGATC
TTACGTTTCTATCCTCACCCGAAGATAGAAATCCCCCGGGAGGAGACTCT
TTATCTGGCCGGGAAAGCAGTTTCCCATATTAATTTAATTTTAAACCGTA
TGATAGAATTGTTGCTGGTGGAAAAGTGGGAGGATTCCTTGAAGTTCCTA
GTTTTGCTCTGCGGCATCAATTTGCTGGGCGATTGCTTCAACGGATTGAC
TTTGCTTATATTTGGACACTTGTTTATTTTTACCGTACCAAAACTGTACG
AGTCGTATAAGCCATTCGTTGATGTCCAGATCCGAAAGTTCCGTAAATGC
AAGATAGATAAATCGAACGTTGAAAAACCGATTTGTATTCAGAAAGAGTG
TCCGCCGGAGTCAGCATACGAGGGTCAGGAATCCAAAGAGGGCAAAGTAC
TATATGAGCCATGCGATAATGAGCCACTTCGAAATCTCCTAGAGCTCCAC
AAAGGATGTCGTTGTCCTGATTGCGAGCACCGGTATTTGCCAGTTGAGGC
TCGCTAAACTATATTCATATGAATAAGAATCCACCCTCTTTGATGTTATT
GTTCAAAATTAATGTTGTGGAAATATATATTCTACATATTTTCCACTCAA
AAAAAAAAAAAAAAAAA

IP21332.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:22:45
Subject Length Description Subject Range Query Range Score Percent Strand
Rtnl2.a 1031 Rtnl2.a 87..1031 1..945 4725 100 Plus
Rtnl2-RA 475 Rtnl2-RA 1..438 128..565 2190 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:27:29
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 3355395..3355959 565..1 2825 100 Minus
chr3R 27901430 chr3R 3354940..3355324 948..564 1925 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:45:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:27:27
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 7529319..7529883 565..1 2825 100 Minus
3R 32079331 3R 7528863..7529248 949..564 1930 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:09:33
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 7270150..7270714 565..1 2825 100 Minus
3R 31820162 3R 7269694..7270079 949..564 1930 100 Minus
Blast to na_te.dros performed on 2019-03-16 09:27:27 has no hits.

IP21332.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:28:39 Download gff for IP21332.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 3354940..3355323 565..948 100 <- Minus
chr3R 3355396..3355959 1..564 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:51:15 Download gff for IP21332.complete
Subject Subject Range Query Range Percent Splice Strand
Rtnl2-RA 1..433 138..573 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:46:41 Download gff for IP21332.complete
Subject Subject Range Query Range Percent Splice Strand
Rtnl2-RA 1..433 138..573 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:01:38 Download gff for IP21332.complete
Subject Subject Range Query Range Percent Splice Strand
Rtnl2-RB 1..768 90..857 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:09:44 Download gff for IP21332.complete
Subject Subject Range Query Range Percent Splice Strand
Rtnl2-RB 1..768 90..857 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-04-28 18:58:35 Download gff for IP21332.complete
Subject Subject Range Query Range Percent Splice Strand
Rtnl2-RA 1..443 128..573 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:46:41 Download gff for IP21332.complete
Subject Subject Range Query Range Percent Splice Strand
Rtnl2-RA 1..443 128..573 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:01:38 Download gff for IP21332.complete
Subject Subject Range Query Range Percent Splice Strand
Rtnl2-RB 1..948 1..948 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:09:44 Download gff for IP21332.complete
Subject Subject Range Query Range Percent Splice Strand
Rtnl2-RB 1..948 1..948 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:28:39 Download gff for IP21332.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7528864..7529247 565..948 100 <- Minus
3R 7529320..7529883 1..564 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:28:39 Download gff for IP21332.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7528864..7529247 565..948 100 <- Minus
3R 7529320..7529883 1..564 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:28:39 Download gff for IP21332.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7528864..7529247 565..948 100 <- Minus
3R 7529320..7529883 1..564 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:01:38 Download gff for IP21332.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 3354586..3354969 565..948 100 <- Minus
arm_3R 3355042..3355605 1..564 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:32:30 Download gff for IP21332.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7269695..7270078 565..948 100 <- Minus
3R 7270151..7270714 1..564 100   Minus

IP21332.pep Sequence

Translation from 89 to 856

> IP21332.pep
MSTDTLIKAKDSSQIFMDLKNLLLWRNSRKTLIVFTGILLLLLDVMVHSV
ISVISMVGITVLIAAIGHRLLVQFWSIWKKDENKDQILRFYPHPKIEIPR
EETLYLAGKAVSHINLILNRMIELLLVEKWEDSLKFLVLLCGINLLGDCF
NGLTLLIFGHLFIFTVPKLYESYKPFVDVQIRKFRKCKIDKSNVEKPICI
QKECPPESAYEGQESKEGKVLYEPCDNEPLRNLLELHKGCRCPDCEHRYL
PVEAR*

IP21332.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 17:25:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17296-PA 259 GF17296-PA 9..259 9..255 725 55.8 Plus
Dana\GF14162-PA 596 GF14162-PA 401..592 19..208 225 32.1 Plus
Dana\GF10829-PA 294 GF10829-PA 29..243 18..237 194 28.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 17:25:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25105-PA 246 GG25105-PA 1..245 17..254 938 78.8 Plus
Dere\GG24328-PA 607 GG24328-PA 411..607 19..216 223 31.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 17:25:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11424-PA 234 GH11424-PA 38..234 19..216 218 30.3 Plus
Dgri\GH17123-PA 245 GH17123-PA 3..162 20..179 148 38.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:21:43
Subject Length Description Subject Range Query Range Score Percent Strand
Rtnl2-PC 255 CG1279-PC 1..255 1..255 1338 100 Plus
Rtnl2-PB 255 CG1279-PB 1..255 1..255 1338 100 Plus
Rtnl1-PC 202 CG33113-PC 6..202 19..216 235 32.3 Plus
Rtnl1-PG 224 CG33113-PG 28..224 19..216 235 32.3 Plus
Rtnl1-PD 224 CG33113-PD 28..224 19..216 235 32.3 Plus
Rtnl1-PL 222 CG33113-PL 26..222 19..216 233 31.8 Plus
Rtnl1-PA 222 CG33113-PA 26..222 19..216 232 31.8 Plus
Rtnl1-PJ 234 CG33113-PJ 38..234 19..216 232 31.8 Plus
Rtnl1-PI 234 CG33113-PI 38..234 19..216 232 31.8 Plus
Rtnl1-PB 234 CG33113-PB 38..234 19..216 232 31.8 Plus
Rtnl1-PE 234 CG33113-PE 38..234 19..216 232 31.8 Plus
Rtnl1-PF 595 CG33113-PF 399..595 19..216 232 31.8 Plus
Rtnl1-PH 607 CG33113-PH 411..607 19..216 232 31.8 Plus
CG42853-PA 284 CG42853-PA 25..240 15..226 182 25.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 17:25:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11728-PA 258 GI11728-PA 9..240 16..249 247 30.7 Plus
Dmoj\GI14630-PA 234 GI14630-PA 38..234 19..216 230 31.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 17:25:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12168-PA 319 GL12168-PA 14..269 7..245 407 37.1 Plus
Dper\GL26483-PA 571 GL26483-PA 375..571 19..216 217 31.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 17:25:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11813-PB 321 GA11813-PB 14..227 7..219 408 41.4 Plus
Dpse\GA11813-PA 298 GA11813-PA 1..204 17..219 398 42.9 Plus
Dpse\GA28881-PA 224 GA28881-PA 27..224 18..216 218 31.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 17:25:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10472-PA 238 GM10472-PA 1..238 17..255 1114 89.3 Plus
Dsec\GM18049-PA 234 GM18049-PA 38..234 19..216 224 31.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 17:25:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19473-PA 238 GD19473-PA 1..238 17..255 1108 88.9 Plus
Dsim\GD22669-PA 234 GD22669-PA 38..234 19..216 224 31.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 17:25:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11400-PA 265 GJ11400-PA 21..204 22..208 258 34.8 Plus
Dvir\GJ17140-PA 236 GJ17140-PA 38..235 19..217 225 31.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 17:25:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11074-PA 247 GK11074-PA 6..247 9..255 468 42.4 Plus
Dwil\GK24458-PA 587 GK24458-PA 389..548 19..179 214 31.7 Plus
Dwil\GK19145-PA 159 GK19145-PA 19..158 19..159 145 31.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 17:25:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25782-PA 264 GE25782-PA 1..263 1..254 1007 79.1 Plus
Dyak\GE18708-PA 234 GE18708-PA 37..234 18..216 233 31.7 Plus

IP21332.hyp Sequence

Translation from 89 to 856

> IP21332.hyp
MSTDTLIKAKDSSQIFMDLKNLLLWRNSRKTLIVFTGILLLLLDVMVHSV
ISVISMVGITVLIAAIGHRLLVQFWSIWKKDENKDQILRFYPHPKIEIPR
EETLYLAGKAVSHINLILNRMIELLLVEKWEDSLKFLVLLCGINLLGDCF
NGLTLLIFGHLFIFTVPKLYESYKPFVDVQIRKFRKCKIDKSNVEKPICI
QKECPPESAYEGQESKEGKVLYEPCDNEPLRNLLELHKGCRCPDCEHRYL
PVEAR*

IP21332.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:20:08
Subject Length Description Subject Range Query Range Score Percent Strand
Rtnl2-PC 255 CG1279-PC 1..255 1..255 1338 100 Plus
Rtnl2-PB 255 CG1279-PB 1..255 1..255 1338 100 Plus
Rtnl1-PC 202 CG33113-PC 6..202 19..216 235 32.3 Plus
Rtnl1-PG 224 CG33113-PG 28..224 19..216 235 32.3 Plus
Rtnl1-PD 224 CG33113-PD 28..224 19..216 235 32.3 Plus