Clone IP21411 Report

Search the DGRC for IP21411

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:214
Well:11
Vector:pOT2
Associated Gene/TranscriptCG32263-RA
Protein status:IP21411.pep: gold
Sequenced Size:708

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32263 2008-04-29 Release 5.5 accounting
CG32263 2008-05-05 Release 5.5 slip selected
CG32263 2008-08-15 Release 5.9 accounting
CG32263 2008-12-18 5.12 accounting

Clone Sequence Records

IP21411.complete Sequence

708 bp assembled on 2008-05-22

GenBank Submission: BT031076

> IP21411.complete
ACAAGACAACAAAATAGGATCAGATGGAATTATGATGTTTAGCTGGACTC
GACTGGCCAATCCGCTAAAGATGAGCTGCCAGTTAGTAACGCATTTCTCG
ACAGCCCCCCCTCCGAATGCAAAATTCTGGACGAAGCTGTTCGGAAAGTA
CCTGTTGCTGACGAATACCATCGGATCGGGACTGCTCCTCGCCATCGGCG
ATGCAATTGCTCAGCAGTACGAGAGGTTTGGTGAAAAGAAAGCCTTTGAC
TACTCTCGCTCAGGATGCATGATGATTACGGGCTCGGTGATTGGTCCGAT
TCAGCACGGCTTCTATCTGCTGTTGGATGGGGTTCTACCGGGCACTAGTG
GATGGGGTGTGCTGCATAAGATACTCGTGGATCAGTTAATCATGTCACCC
ATCTATATATTCCTGTTTTTTTACGTCAGCAGCTTGCTGGGCGGAAAGAG
TTTCGTGGAGTGCAATAGCGAGCTGTCCGAGAAGTTCCTCTACACATGGA
TGTTGGACTGCTGCTTTTGGCCGGGTCTGCAATATCTTAACTTCCGCTTC
CTCAATTCCCTCTATCGCGTGGTGTTCGTCAATGTAGCCAATTGCGTGTA
CGTCGTTCTGCTTTCTCATATAAAGTACGGGGTTTCCAACCACGATCCCT
AGTTATATTTAATGGCAATTAAACTTAATAAGCAAAATAAAAAAAAAAAA
AAAAAAAA

IP21411.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:51:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG32263.a 803 CG32263.a 114..802 1..689 3445 100 Plus
CG32263-RA 803 CG32263-RA 114..802 1..689 3445 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-17 00:16:09
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 3809752..3810439 688..1 3185 97.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:45:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-17 00:16:07
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3810313..3811001 689..1 3445 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:48:30
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 3810313..3811001 689..1 3445 100 Minus
Blast to na_te.dros performed on 2019-03-17 00:16:08 has no hits.

IP21411.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-17 00:17:00 Download gff for IP21411.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 3809752..3810439 1..688 97   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:25:15 Download gff for IP21411.complete
Subject Subject Range Query Range Percent Splice Strand
CG32263-RA 1..621 32..652 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:38:02 Download gff for IP21411.complete
Subject Subject Range Query Range Percent Splice Strand
CG32263-RA 1..621 32..652 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:36:00 Download gff for IP21411.complete
Subject Subject Range Query Range Percent Splice Strand
CG32263-RA 1..621 32..652 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:43:46 Download gff for IP21411.complete
Subject Subject Range Query Range Percent Splice Strand
CG32263-RA 1..621 32..652 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:18:05 Download gff for IP21411.complete
Subject Subject Range Query Range Percent Splice Strand
CG32263-RA 1..621 32..652 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:07:13 Download gff for IP21411.complete
Subject Subject Range Query Range Percent Splice Strand
CG32263-RA 1..621 32..652 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:38:01 Download gff for IP21411.complete
Subject Subject Range Query Range Percent Splice Strand
CG32263-RA 114..801 1..688 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:36:00 Download gff for IP21411.complete
Subject Subject Range Query Range Percent Splice Strand
CG32263-RA 114..801 1..688 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:43:47 Download gff for IP21411.complete
Subject Subject Range Query Range Percent Splice Strand
CG32263-RA 1..621 32..652 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:18:05 Download gff for IP21411.complete
Subject Subject Range Query Range Percent Splice Strand
CG32263-RA 114..801 1..688 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:17:00 Download gff for IP21411.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3810314..3811001 1..688 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:17:00 Download gff for IP21411.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3810314..3811001 1..688 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:17:00 Download gff for IP21411.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3810314..3811001 1..688 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:36:00 Download gff for IP21411.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3810314..3811001 1..688 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:20:47 Download gff for IP21411.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3810314..3811001 1..688 100   Minus

IP21411.hyp Sequence

Translation from 0 to 651

> IP21411.hyp
QDNKIGSDGIMMFSWTRLANPLKMSCQLVTHFSTAPPPNAKFWTKLFGKY
LLLTNTIGSGLLLAIGDAIAQQYERFGEKKAFDYSRSGCMMITGSVIGPI
QHGFYLLLDGVLPGTSGWGVLHKILVDQLIMSPIYIFLFFYVSSLLGGKS
FVECNSELSEKFLYTWMLDCCFWPGLQYLNFRFLNSLYRVVFVNVANCVY
VVLLSHIKYGVSNHDP*

IP21411.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:21:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG32263-PA 206 CG32263-PA 1..206 11..216 1107 100 Plus
CG32262-PA 273 CG32262-PA 69..245 43..216 400 46.3 Plus
CG1662-PB 245 CG1662-PB 73..238 49..213 244 36.1 Plus
CG1662-PA 245 CG1662-PA 73..238 49..213 244 36.1 Plus
CG5906-PA 196 CG5906-PA 25..186 49..209 236 35.8 Plus

IP21411.pep Sequence

Translation from 1 to 651

> IP21411.pep
QDNKIGSDGIMMFSWTRLANPLKMSCQLVTHFSTAPPPNAKFWTKLFGKY
LLLTNTIGSGLLLAIGDAIAQQYERFGEKKAFDYSRSGCMMITGSVIGPI
QHGFYLLLDGVLPGTSGWGVLHKILVDQLIMSPIYIFLFFYVSSLLGGKS
FVECNSELSEKFLYTWMLDCCFWPGLQYLNFRFLNSLYRVVFVNVANCVY
VVLLSHIKYGVSNHDP*

IP21411.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:55:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10257-PA 156 GF10257-PA 2..153 65..210 495 57.9 Plus
Dana\GF10258-PA 293 GF10258-PA 78..248 43..210 410 46.2 Plus
Dana\GF19409-PA 254 GF19409-PA 84..245 49..209 260 38.3 Plus
Dana\GF24503-PA 236 GF24503-PA 60..221 49..209 255 38.3 Plus
Dana\GF20998-PA 194 GF20998-PA 45..187 71..215 154 28.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:55:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14244-PA 202 GG14244-PA 1..201 12..210 905 83.6 Plus
Dere\GG14245-PA 272 GG14245-PA 78..254 43..216 407 46.3 Plus
Dere\GG17779-PA 245 GG17779-PA 72..238 48..213 254 36.5 Plus
Dere\GG13873-PA 196 GG13873-PA 7..186 15..209 239 33.7 Plus
Dere\GG13550-PA 204 GG13550-PA 11..177 46..208 189 28.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:55:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15047-PA 299 GH15047-PA 65..240 39..209 387 43.2 Plus
Dgri\GH24495-PA 245 GH24495-PA 53..219 48..213 246 35.3 Plus
Dgri\GH16716-PA 220 GH16716-PA 22..187 47..210 190 31.3 Plus
Dgri\GH24500-PA 193 GH24500-PA 23..188 49..215 148 24.4 Plus
Dgri\GH24499-PA 203 GH24499-PA 34..188 60..216 145 25.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:26:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG32263-PA 206 CG32263-PA 1..206 11..216 1107 100 Plus
CG32262-PA 273 CG32262-PA 69..245 43..216 400 46.3 Plus
CG1662-PB 245 CG1662-PB 73..238 49..213 244 36.1 Plus
CG1662-PA 245 CG1662-PA 73..238 49..213 244 36.1 Plus
CG5906-PA 196 CG5906-PA 25..186 49..209 236 35.8 Plus
CG12355-PE 204 CG12355-PE 11..177 46..208 180 27.6 Plus
CG12355-PB 204 CG12355-PB 11..177 46..208 180 27.6 Plus
plh-PB 193 CG2022-PB 11..172 49..209 159 25.9 Plus
CG14777-PF 196 CG14777-PF 40..181 68..208 155 27.5 Plus
CG14777-PC 196 CG14777-PC 40..181 68..208 155 27.5 Plus
CG14777-PE 196 CG14777-PE 40..181 68..208 155 27.5 Plus
CG14777-PD 196 CG14777-PD 40..181 68..208 155 27.5 Plus
CG14777-PB 196 CG14777-PB 40..181 68..208 155 27.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:55:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12806-PA 280 GI12806-PA 77..246 43..209 409 45.3 Plus
Dmoj\GI15250-PA 238 GI15250-PA 54..223 48..216 252 37.4 Plus
Dmoj\GI13797-PA 217 GI13797-PA 23..191 49..216 233 36.1 Plus
Dmoj\GI12229-PA 200 GI12229-PA 12..177 47..208 193 28.4 Plus
Dmoj\GI16042-PA 189 GI16042-PA 12..160 60..208 155 30.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:55:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20995-PA 209 GL20995-PA 1..169 46..214 569 60.4 Plus
Dper\GL20996-PA 298 GL20996-PA 80..256 43..216 402 44.6 Plus
Dper\GL26921-PA 239 GL26921-PA 68..234 48..213 247 35.3 Plus
Dper\GL25076-PA 197 GL25076-PA 25..186 49..209 245 37.7 Plus
Dper\GL25660-PA 199 GL25660-PA 11..177 46..208 193 30.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:55:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16798-PA 180 GA16798-PA 1..173 46..216 571 59.5 Plus
Dpse\GA23490-PA 298 GA23490-PA 80..256 43..216 402 44.6 Plus
Dpse\GA14082-PA 239 GA14082-PA 68..234 48..213 247 35.3 Plus
Dpse\GA19218-PA 197 GA19218-PA 25..186 49..209 245 37.7 Plus
Dpse\GA23640-PA 199 GA23640-PA 11..177 46..208 193 30.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:55:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14037-PA 205 GM14037-PA 1..205 12..216 988 92.3 Plus
Dsec\GM14038-PA 282 GM14038-PA 78..254 43..216 406 46.3 Plus
Dsec\GM11631-PA 245 GM11631-PA 72..238 48..213 256 36.5 Plus
Dsec\GM24695-PA 196 GM24695-PA 25..186 49..209 239 36.4 Plus
Dsec\GM19141-PA 196 GM19141-PA 39..181 66..208 160 29.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:55:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13316-PA 207 GD13316-PA 1..207 12..216 1029 94.2 Plus
Dsim\GD13317-PA 282 GD13317-PA 78..254 43..216 406 46.3 Plus
Dsim\GD17122-PA 245 GD17122-PA 72..238 48..213 256 36.5 Plus
Dsim\GD17579-PA 196 GD17579-PA 25..186 49..209 239 36.4 Plus
Dsim\GD12563-PA 205 GD12563-PA 12..178 46..208 178 28.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:55:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12951-PA 285 GJ12951-PA 72..245 39..209 406 45.4 Plus
Dvir\GJ14822-PA 238 GJ14822-PA 53..219 48..213 242 35.3 Plus
Dvir\GJ11665-PA 192 GJ11665-PA 25..183 49..206 233 36.5 Plus
Dvir\GJ11459-PA 197 GJ11459-PA 11..177 46..208 216 32.9 Plus
Dvir\GJ11024-PA 193 GJ11024-PA 8..172 46..209 157 26.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:55:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19158-PA 178 GK19158-PA 1..166 46..211 539 58.4 Plus
Dwil\GK20364-PA 309 GK20364-PA 74..250 43..216 381 43.5 Plus
Dwil\GK25287-PA 231 GK25287-PA 61..228 44..209 251 35.7 Plus
Dwil\GK19153-PA 197 GK19153-PA 19..176 48..204 222 34.2 Plus
Dwil\GK10054-PA 206 GK10054-PA 37..189 60..216 148 27.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:55:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20673-PA 207 GE20673-PA 1..207 12..216 847 76.3 Plus
Dyak\GE20674-PA 272 GE20674-PA 78..254 43..216 405 46.3 Plus
Dyak\GE17073-PA 246 GE17073-PA 73..239 48..213 255 36.5 Plus
Dyak\GE20165-PA 196 GE20165-PA 25..186 49..209 237 36.4 Plus
Dyak\GE19851-PA 204 GE19851-PA 11..177 46..208 186 28.8 Plus