IP21419.complete Sequence
1413 bp assembled on 2008-05-27
GenBank Submission: BT032979
> IP21419.complete
AAAAGCCCCCACACAAAATGTGGAAGTGGATAATCAATATCATATTATTA
TCAGTGGTGCAAGCCAGCAAAAAAGTCGATGGACAAATATCTCCAAGAAC
AACTTCCCAAAAAATACTTCAACCGTATCCGTGTAACTCCCCACATCCAC
TAACCCAATTTTCCCAAAAGTATCCAAACTCAGGATACCTTTGTTATCCT
CAAAATGAAATTAATAAATACCTATGGTACCCACCGTGGAGCCAATGGGT
AGGATATCAAGGATATCAAACAGGAAATGGATTATATGCACAACTTTCGA
CGGGATCTCAGATTTCATCCTTCCACCATCCCAACTTTCAAATTCCTTTT
GTTCAACTTCTCACTTTACCCGCCCCACCAAGCTTAATCCCACCTGCCTC
TCCCATTCCTTCCCACCAATATCCAGGATTATTTGCGCCACCATCTTTCG
CCCAATTTCCAGGATTACTGGGATCAACGGGCTCGGGTCCATCGGGAATA
CCAAATCTTCCCGGGACAAATGCCTCTCCAGGTTGGAGTTCACCTGGATC
TTCGATTCCTTCCTACCAACTGCCAGGAATACAACAGCAACCAGGCTCAA
GTCCAGTAGAATATCCACATGCTCCTATCAAACCTCCAAGTTCCGCCCCG
GCAGGTTGGAGCTCACCAGGATCACCTATTCCTCCCCCTTCACTACCAGG
ACTACCGGGAACACCAGATCAGAATCCATGGGGATCTGCTGATCGTCCCG
CCCATCCTCCGGCATCGCCCATACAACCAGGTTGGAGTCCACCAGGATCA
TCTTTTCCTCCCTCTCCCCAATCAGGACCACCGGGACCACCAAATTGGAA
TCAATTGGAGTCTGCCAATCGTCCTGTCTATCCTCCGGAAATGCCCATAC
CTCCAGTTTGGAATTCGCGTAGATCTTCGAATCCTTCCGCCCAACTTCCA
CCATTACAAGAGGCACCCTTGGGATCTCTTGGACCCTCCCAACTACCTCC
AGGGCTACCAGCGCCACCTAGCTGGAGTTCATTGGAATCTTCAAATCCTC
TTGTCCAACGTCCAGAATTAATGGCACCACCAAGTTTGAGTCCATCTGGA
TCTTCGAATTCTGTCCTTCAGCCCTTGCCCGCAAAACCAAATTGGCGTTC
ATCGGGATCCCCGAATTCGCCTCTTTACCCTCCAGGATTACCCGCACCAC
CAAGTGAGAGTATACCTGATATCTCCCCAAATCAGAAAACACGATCCGCC
GGATCACCGCCATAGGTGAATACAAACAATCTAGAGGTAGAAAACAACTG
TGCCACCAATGAAAAACAGCTATTGAGTTAAGTAACAAAATAGCAACAAG
CAAAAATATGTATTTAAAAATATATGTGGCATTAAAAAAAATATAAAAAA
AAAAAAAAAAAAA
IP21419.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 16:52:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
BG642163-RA | 1485 | BG642163-RA | 18..1422 | 1..1405 | 7010 | 99.9 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:13:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 4640573..4641871 | 96..1394 | 6345 | 99.2 | Plus |
chr2L | 23010047 | chr2L | 4640420..4640514 | 1..95 | 475 | 100 | Plus |
chr2L | 23010047 | chr2L | 4641129..4641263 | 778..912 | 240 | 78.5 | Plus |
chr2L | 23010047 | chr2L | 4641255..4641389 | 652..786 | 240 | 78.5 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:45:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:13:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 4641449..4642758 | 96..1405 | 6535 | 99.9 | Plus |
2L | 23513712 | 2L | 4641296..4641390 | 1..95 | 475 | 100 | Plus |
2L | 23513712 | 2L | 4642005..4642139 | 778..912 | 240 | 78.5 | Plus |
2L | 23513712 | 2L | 4642131..4642265 | 652..786 | 240 | 78.5 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:49:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 4641449..4642758 | 96..1405 | 6535 | 99.9 | Plus |
2L | 23513712 | 2L | 4641296..4641390 | 1..95 | 475 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-15 23:13:10 has no hits.
IP21419.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:13:51 Download gff for
IP21419.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 4640420..4640514 | 1..95 | 100 | -> | Plus |
chr2L | 4640573..4641852 | 96..1375 | 99 | -> | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:25:25 Download gff for
IP21419.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
BG642163-RA | 1..1248 | 18..1265 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:40:10 Download gff for
IP21419.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
BG642163-RA | 1..1248 | 18..1265 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:32:36 Download gff for
IP21419.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
BG642163-RA | 1..1248 | 18..1265 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:46:24 Download gff for
IP21419.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
BG642163-RA | 1..1248 | 18..1265 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:24:03 Download gff for
IP21419.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
BG642163-RA | 1..1248 | 18..1265 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:09:57 Download gff for
IP21419.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
BG642163-RA | 1..1394 | 1..1394 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:40:10 Download gff for
IP21419.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
BG642163-RA | 1..1394 | 1..1394 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:32:36 Download gff for
IP21419.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
BG642163-RA | 1..1394 | 1..1394 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:46:24 Download gff for
IP21419.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
BG642163-RA | 1..1248 | 18..1265 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:24:03 Download gff for
IP21419.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
BG642163-RA | 1..1394 | 1..1394 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:13:51 Download gff for
IP21419.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 4641296..4641390 | 1..95 | 100 | -> | Plus |
2L | 4641449..4642747 | 96..1394 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:13:51 Download gff for
IP21419.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 4641296..4641390 | 1..95 | 100 | -> | Plus |
2L | 4641449..4642747 | 96..1394 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:13:51 Download gff for
IP21419.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 4641296..4641390 | 1..95 | 100 | -> | Plus |
2L | 4641449..4642747 | 96..1394 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:32:36 Download gff for
IP21419.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 4641296..4641390 | 1..95 | 100 | -> | Plus |
arm_2L | 4641449..4642747 | 96..1394 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:22:12 Download gff for
IP21419.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 4641449..4642747 | 96..1394 | 100 | | Plus |
2L | 4641296..4641390 | 1..95 | 100 | -> | Plus |
IP21419.hyp Sequence
Translation from 2 to 1264
> IP21419.hyp
KPPHKMWKWIINIILLSVVQASKKVDGQISPRTTSQKILQPYPCNSPHPL
TQFSQKYPNSGYLCYPQNEINKYLWYPPWSQWVGYQGYQTGNGLYAQLST
GSQISSFHHPNFQIPFVQLLTLPAPPSLIPPASPIPSHQYPGLFAPPSFA
QFPGLLGSTGSGPSGIPNLPGTNASPGWSSPGSSIPSYQLPGIQQQPGSS
PVEYPHAPIKPPSSAPAGWSSPGSPIPPPSLPGLPGTPDQNPWGSADRPA
HPPASPIQPGWSPPGSSFPPSPQSGPPGPPNWNQLESANRPVYPPEMPIP
PVWNSRRSSNPSAQLPPLQEAPLGSLGPSQLPPGLPAPPSWSSLESSNPL
VQRPELMAPPSLSPSGSSNSVLQPLPAKPNWRSSGSPNSPLYPPGLPAPP
SESIPDISPNQKTRSAGSPP*
IP21419.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:21:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
BG642163-PB | 415 | CG34102-PB | 1..415 | 6..420 | 2309 | 100 | Plus |
BG642163-PA | 415 | CG34102-PA | 1..415 | 6..420 | 2309 | 100 | Plus |
CG15635-PB | 1136 | CG15635-PB | 707..1065 | 54..420 | 249 | 28.7 | Plus |
CG15021-PA | 420 | CG15021-PA | 46..383 | 90..419 | 242 | 29.1 | Plus |
CG15635-PB | 1136 | CG15635-PB | 635..1000 | 43..420 | 228 | 28.1 | Plus |
CG15635-PB | 1136 | CG15635-PB | 130..534 | 45..420 | 224 | 29.2 | Plus |
CG15635-PB | 1136 | CG15635-PB | 421..736 | 76..420 | 224 | 27.9 | Plus |
Muc91C-PB | 949 | CG7709-PB | 118..408 | 123..420 | 218 | 32.3 | Plus |
CG15635-PB | 1136 | CG15635-PB | 85..469 | 120..420 | 199 | 27.6 | Plus |
CG15635-PB | 1136 | CG15635-PB | 796..1120 | 27..379 | 176 | 26.3 | Plus |
CG15635-PB | 1136 | CG15635-PB | 47..351 | 186..420 | 170 | 28 | Plus |
CG15635-PB | 1136 | CG15635-PB | 33..261 | 200..420 | 164 | 30 | Plus |
CG15635-PB | 1136 | CG15635-PB | 891..1126 | 27..283 | 156 | 29.4 | Plus |
IP21419.pep Sequence
Translation from 2 to 1264
> IP21419.pep
KPPHKMWKWIINIILLSVVQASKKVDGQISPRTTSQKILQPYPCNSPHPL
TQFSQKYPNSGYLCYPQNEINKYLWYPPWSQWVGYQGYQTGNGLYAQLST
GSQISSFHHPNFQIPFVQLLTLPAPPSLIPPASPIPSHQYPGLFAPPSFA
QFPGLLGSTGSGPSGIPNLPGTNASPGWSSPGSSIPSYQLPGIQQQPGSS
PVEYPHAPIKPPSSAPAGWSSPGSPIPPPSLPGLPGTPDQNPWGSADRPA
HPPASPIQPGWSPPGSSFPPSPQSGPPGPPNWNQLESANRPVYPPEMPIP
PVWNSRRSSNPSAQLPPLQEAPLGSLGPSQLPPGLPAPPSWSSLESSNPL
VQRPELMAPPSLSPSGSSNSVLQPLPAKPNWRSSGSPNSPLYPPGLPAPP
SESIPDISPNQKTRSAGSPP*
IP21419.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:19:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
BG642163-PB | 415 | CG34102-PB | 1..415 | 6..420 | 2309 | 100 | Plus |
BG642163-PA | 415 | CG34102-PA | 1..415 | 6..420 | 2309 | 100 | Plus |
CG15635-PB | 1136 | CG15635-PB | 707..1065 | 54..420 | 249 | 28.7 | Plus |
CG15021-PA | 420 | CG15021-PA | 46..383 | 90..419 | 242 | 29.1 | Plus |
CG15635-PB | 1136 | CG15635-PB | 635..1000 | 43..420 | 228 | 28.1 | Plus |
CG15635-PB | 1136 | CG15635-PB | 130..534 | 45..420 | 224 | 29.2 | Plus |
CG15635-PB | 1136 | CG15635-PB | 421..736 | 76..420 | 224 | 27.9 | Plus |
Muc91C-PB | 949 | CG7709-PB | 118..408 | 123..420 | 218 | 32.3 | Plus |
Muc91C-PA | 950 | CG7709-PA | 119..409 | 123..420 | 218 | 32.3 | Plus |
RpII215-PA | 1887 | CG1554-PA | 1500..1803 | 126..419 | 218 | 27.4 | Plus |
RpII215-PA | 1887 | CG1554-PA | 1563..1881 | 126..413 | 209 | 27.9 | Plus |
Muc91C-PB | 949 | CG7709-PB | 241..523 | 124..417 | 206 | 33 | Plus |
Muc91C-PA | 950 | CG7709-PA | 242..524 | 124..417 | 206 | 33 | Plus |
CG15635-PB | 1136 | CG15635-PB | 85..469 | 120..420 | 199 | 27.6 | Plus |
Muc91C-PB | 949 | CG7709-PB | 177..448 | 130..420 | 199 | 31.7 | Plus |
Muc91C-PA | 950 | CG7709-PA | 178..449 | 130..420 | 199 | 31.7 | Plus |
osa-PE | 2555 | CG7467-PE | 365..656 | 125..411 | 195 | 27.9 | Plus |
osa-PC | 2556 | CG7467-PC | 365..656 | 125..411 | 195 | 27.9 | Plus |
osa-PF | 2559 | CG7467-PF | 365..656 | 125..411 | 195 | 27.9 | Plus |
osa-PA | 2703 | CG7467-PA | 365..656 | 125..411 | 195 | 27.9 | Plus |
osa-PB | 2716 | CG7467-PB | 365..656 | 125..411 | 195 | 27.9 | Plus |
osa-PD | 2716 | CG7467-PD | 365..656 | 125..411 | 195 | 27.9 | Plus |
frm-PJ | 752 | CG10625-PJ | 129..400 | 131..399 | 194 | 29.4 | Plus |
frm-PI | 766 | CG10625-PI | 129..400 | 131..399 | 194 | 29.4 | Plus |
frm-PH | 1180 | CG10625-PH | 543..814 | 131..399 | 194 | 29.4 | Plus |
Vml-PB | 578 | CG34333-PB | 87..386 | 110..405 | 190 | 27.3 | Plus |
Vml-PA | 578 | CG34333-PA | 87..386 | 110..405 | 190 | 27.3 | Plus |
Muc91C-PB | 949 | CG7709-PB | 345..640 | 123..419 | 188 | 30.1 | Plus |
Muc91C-PA | 950 | CG7709-PA | 346..641 | 123..419 | 188 | 30.1 | Plus |
Vml-PB | 578 | CG34333-PB | 183..465 | 110..418 | 186 | 28.2 | Plus |
Vml-PA | 578 | CG34333-PA | 183..465 | 110..418 | 186 | 28.2 | Plus |
Vml-PB | 578 | CG34333-PB | 85..330 | 174..405 | 185 | 29.2 | Plus |
Vml-PA | 578 | CG34333-PA | 85..330 | 174..405 | 185 | 29.2 | Plus |
Sec24CD-PA | 1193 | CG10882-PA | 106..393 | 124..405 | 185 | 27.7 | Plus |
Sec24CD-PB | 1193 | CG10882-PB | 106..393 | 124..405 | 185 | 27.7 | Plus |
Sec24CD-PC | 1231 | CG10882-PC | 106..393 | 124..405 | 185 | 27.7 | Plus |
osa-PE | 2555 | CG7467-PE | 1160..1532 | 42..404 | 184 | 25.3 | Plus |
osa-PC | 2556 | CG7467-PC | 1161..1533 | 42..404 | 184 | 25.3 | Plus |
osa-PF | 2559 | CG7467-PF | 1164..1536 | 42..404 | 184 | 25.3 | Plus |
dpy-PY | 18095 | CG33196-PY | 14181..14501 | 119..407 | 183 | 28.1 | Plus |
dpy-PS | 18641 | CG33196-PS | 14727..15047 | 119..407 | 183 | 28.1 | Plus |
dpy-PV | 20404 | CG33196-PV | 16490..16810 | 119..407 | 183 | 28.1 | Plus |
dpy-PP | 20710 | CG33196-PP | 16796..17116 | 119..407 | 183 | 28.1 | Plus |
dpy-PU | 21657 | CG33196-PU | 17743..18063 | 119..407 | 183 | 28.1 | Plus |
dpy-PT | 22300 | CG33196-PT | 18386..18706 | 119..407 | 183 | 28.1 | Plus |
dpy-PO | 22743 | CG33196-PO | 18829..19149 | 119..407 | 183 | 28.1 | Plus |
dpy-PR | 22830 | CG33196-PR | 18916..19236 | 119..407 | 183 | 28.1 | Plus |
dpy-PQ | 22949 | CG33196-PQ | 19035..19355 | 119..407 | 183 | 28.1 | Plus |
osa-PE | 2555 | CG7467-PE | 224..526 | 130..420 | 181 | 25.3 | Plus |
osa-PC | 2556 | CG7467-PC | 224..526 | 130..420 | 181 | 25.3 | Plus |
osa-PF | 2559 | CG7467-PF | 224..526 | 130..420 | 181 | 25.3 | Plus |
osa-PA | 2703 | CG7467-PA | 224..526 | 130..420 | 181 | 25.3 | Plus |
osa-PB | 2716 | CG7467-PB | 224..526 | 130..420 | 181 | 25.3 | Plus |
osa-PD | 2716 | CG7467-PD | 224..526 | 130..420 | 181 | 25.3 | Plus |
CG13731-PB | 792 | CG13731-PB | 112..426 | 125..420 | 179 | 25.9 | Plus |
Sec24CD-PA | 1193 | CG10882-PA | 104..456 | 40..318 | 178 | 28.2 | Plus |
Sec24CD-PB | 1193 | CG10882-PB | 104..456 | 40..318 | 178 | 28.2 | Plus |
Sec24CD-PC | 1231 | CG10882-PC | 104..456 | 40..318 | 178 | 28.2 | Plus |
CG15635-PB | 1136 | CG15635-PB | 796..1120 | 27..379 | 176 | 26.3 | Plus |
osa-PA | 2703 | CG7467-PA | 1247..1680 | 41..404 | 176 | 25.4 | Plus |
osa-PB | 2716 | CG7467-PB | 1260..1693 | 41..404 | 176 | 25.4 | Plus |
osa-PD | 2716 | CG7467-PD | 1260..1693 | 41..404 | 176 | 25.4 | Plus |
dpy-PY | 18095 | CG33196-PY | 14007..14337 | 119..420 | 174 | 26.9 | Plus |
dpy-PS | 18641 | CG33196-PS | 14553..14883 | 119..420 | 174 | 26.9 | Plus |
dpy-PV | 20404 | CG33196-PV | 16316..16646 | 119..420 | 174 | 26.9 | Plus |
dpy-PP | 20710 | CG33196-PP | 16622..16952 | 119..420 | 174 | 26.9 | Plus |
dpy-PU | 21657 | CG33196-PU | 17569..17899 | 119..420 | 174 | 26.9 | Plus |
dpy-PT | 22300 | CG33196-PT | 18212..18542 | 119..420 | 174 | 26.9 | Plus |
dpy-PO | 22743 | CG33196-PO | 18655..18985 | 119..420 | 174 | 26.9 | Plus |
dpy-PR | 22830 | CG33196-PR | 18742..19072 | 119..420 | 174 | 26.9 | Plus |
dpy-PQ | 22949 | CG33196-PQ | 18861..19191 | 119..420 | 174 | 26.9 | Plus |
CG13731-PB | 792 | CG13731-PB | 335..637 | 115..420 | 173 | 26.2 | Plus |
pico-PD | 1034 | CG11940-PD | 664..898 | 199..420 | 173 | 27.7 | Plus |
pico-PB | 1034 | CG11940-PB | 664..898 | 199..420 | 173 | 27.7 | Plus |
pico-PC | 1113 | CG11940-PC | 743..977 | 199..420 | 173 | 27.7 | Plus |
pico-PA | 1162 | CG11940-PA | 792..1026 | 199..420 | 173 | 27.7 | Plus |
CG15635-PB | 1136 | CG15635-PB | 47..351 | 186..420 | 170 | 28 | Plus |
Muc91C-PB | 949 | CG7709-PB | 513..850 | 77..418 | 170 | 28.4 | Plus |
Muc91C-PA | 950 | CG7709-PA | 514..851 | 77..418 | 170 | 28.4 | Plus |
dpy-PY | 18095 | CG33196-PY | 13937..14198 | 119..400 | 169 | 28.4 | Plus |
dpy-PS | 18641 | CG33196-PS | 14483..14744 | 119..400 | 169 | 28.4 | Plus |
dpy-PV | 20404 | CG33196-PV | 16246..16507 | 119..400 | 169 | 28.4 | Plus |
dpy-PP | 20710 | CG33196-PP | 16552..16813 | 119..400 | 169 | 28.4 | Plus |
dpy-PU | 21657 | CG33196-PU | 17499..17760 | 119..400 | 169 | 28.4 | Plus |
dpy-PT | 22300 | CG33196-PT | 18142..18403 | 119..400 | 169 | 28.4 | Plus |
dpy-PO | 22743 | CG33196-PO | 18585..18846 | 119..400 | 169 | 28.4 | Plus |
dpy-PR | 22830 | CG33196-PR | 18672..18933 | 119..400 | 169 | 28.4 | Plus |
dpy-PQ | 22949 | CG33196-PQ | 18791..19052 | 119..400 | 169 | 28.4 | Plus |
CG13722-PB | 708 | CG13722-PB | 262..572 | 123..420 | 169 | 26.2 | Plus |
CG7016-PA | 362 | CG7016-PA | 99..311 | 141..340 | 168 | 28.1 | Plus |
CG13731-PB | 792 | CG13731-PB | 63..323 | 125..420 | 166 | 24.7 | Plus |
CG15635-PB | 1136 | CG15635-PB | 33..261 | 200..420 | 164 | 30 | Plus |
frm-PD | 268 | CG10625-PD | 129..264 | 131..276 | 164 | 36.7 | Plus |
frm-PA | 268 | CG10625-PA | 129..264 | 131..276 | 164 | 36.7 | Plus |
frm-PE | 652 | CG10625-PE | 513..648 | 131..276 | 164 | 36.7 | Plus |
frm-PB | 682 | CG10625-PB | 543..678 | 131..276 | 164 | 36.7 | Plus |
frm-PC | 682 | CG10625-PC | 543..678 | 131..276 | 164 | 36.7 | Plus |
CG9411-PA | 993 | CG9411-PA | 351..670 | 157..420 | 164 | 27.1 | Plus |
Muc11A-PB | 1552 | CG32656-PB | 1150..1410 | 124..389 | 164 | 29 | Plus |
frm-PE | 652 | CG10625-PE | 435..645 | 92..337 | 163 | 30.4 | Plus |
CG13722-PB | 708 | CG13722-PB | 410..671 | 121..420 | 162 | 25.2 | Plus |
RpII215-PA | 1887 | CG1554-PA | 1660..1885 | 90..347 | 161 | 29.2 | Plus |
CG9425-PD | 2103 | CG9425-PD | 1291..1586 | 136..419 | 160 | 25.8 | Plus |
CG9425-PC | 2103 | CG9425-PC | 1291..1586 | 136..419 | 160 | 25.8 | Plus |
CG9425-PB | 2103 | CG9425-PB | 1291..1586 | 136..419 | 160 | 25.8 | Plus |
Bap111-PA | 749 | CG7055-PA | 506..748 | 121..416 | 159 | 25.8 | Plus |
Bap111-PA | 749 | CG7055-PA | 516..737 | 113..338 | 159 | 29.2 | Plus |
osa-PE | 2555 | CG7467-PE | 120..452 | 123..420 | 158 | 26.1 | Plus |
osa-PE | 2555 | CG7467-PE | 593..830 | 126..360 | 158 | 26.4 | Plus |
osa-PC | 2556 | CG7467-PC | 120..452 | 123..420 | 158 | 26.1 | Plus |
osa-PC | 2556 | CG7467-PC | 593..830 | 126..360 | 158 | 26.4 | Plus |
osa-PF | 2559 | CG7467-PF | 593..830 | 126..360 | 158 | 26.4 | Plus |
osa-PF | 2559 | CG7467-PF | 120..452 | 123..420 | 158 | 26.1 | Plus |
osa-PA | 2703 | CG7467-PA | 120..452 | 123..420 | 158 | 26.1 | Plus |
osa-PA | 2703 | CG7467-PA | 593..830 | 126..360 | 158 | 26.4 | Plus |
osa-PB | 2716 | CG7467-PB | 120..452 | 123..420 | 158 | 26.1 | Plus |
osa-PB | 2716 | CG7467-PB | 593..830 | 126..360 | 158 | 26.4 | Plus |
osa-PD | 2716 | CG7467-PD | 120..452 | 123..420 | 158 | 26.1 | Plus |
osa-PD | 2716 | CG7467-PD | 593..830 | 126..360 | 158 | 26.4 | Plus |
Muc11A-PB | 1552 | CG32656-PB | 414..689 | 123..419 | 157 | 28.2 | Plus |
CG15635-PB | 1136 | CG15635-PB | 891..1126 | 27..283 | 156 | 29.4 | Plus |
CG13722-PB | 708 | CG13722-PB | 59..406 | 105..420 | 156 | 23.5 | Plus |
CG9425-PD | 2103 | CG9425-PD | 1365..1628 | 153..410 | 156 | 28.3 | Plus |
CG9425-PC | 2103 | CG9425-PC | 1365..1628 | 153..410 | 156 | 28.3 | Plus |
CG9425-PB | 2103 | CG9425-PB | 1365..1628 | 153..410 | 156 | 28.3 | Plus |
CG13731-PB | 792 | CG13731-PB | 27..233 | 172..400 | 155 | 26.6 | Plus |
frm-PD | 268 | CG10625-PD | 113..261 | 157..337 | 153 | 33.3 | Plus |
frm-PA | 268 | CG10625-PA | 113..261 | 157..337 | 153 | 33.3 | Plus |