Clone IP21428 Report

Search the DGRC for IP21428

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:214
Well:28
Vector:pOT2
Associated Gene/TranscriptCG13877-RC
Protein status:IP21428.pep: gold
Sequenced Size:443

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
pyx 2008-05-05 Release 5.5 slip selected

Clone Sequence Records

IP21428.complete Sequence

443 bp assembled on 2010-01-13

GenBank Submission: BT032805.2

> IP21428.complete
CTTTGTAAAATTAAAGAAAATGGTTTACATATGCACTCTTGTGGTGTTGA
TCTTTCCCGTCTTGTTGTTGGGTGCACCATGGGAAGGGTCGCATCCTAAG
TCTCAGGTGGAATACATCAGCAACGACAAGAGAGTTGATTCTGGCTTCGC
CAACCCCAATATCGTGCCCATCACCCAGCCGTCGGTCGTAACGCAAACAG
CTCCTCCTCCGCCGCCAAATTCCAAAAACTTTGCATATAGTCCGATGACG
CAGAGCTGGACCCTCATTGCGCCAGGCGATCCGCTGCCCAATAATGACAC
CCTCGTCTGGAACCAGAGCAATGACAAATGGCTCACTCGCTAAGCAATGC
AACCATCGATGGCTTTGCTTTAATCATTGTGTATTACTATTGAAATAAAT
ATAACTAATTCACTGTAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP21428.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:34:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG13877.a 450 CG13877.a 35..450 1..416 2080 100 Plus
CG13877-RB 508 CG13877-RB 95..508 1..411 2000 99.2 Plus
pyx-RB 2502 pyx-RB 1870..2251 417..36 1910 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:59:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 218238..218618 36..416 1905 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:45:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:59:17
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 218283..218664 36..417 1910 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:51:10
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 218283..218664 36..417 1910 100 Plus
3L 28103327 3L 218161..218195 1..35 175 100 Plus
Blast to na_te.dros performed 2019-03-16 21:59:18
Subject Length Description Subject Range Query Range Score Percent Strand
accord 7404 accord ACCORD 7404bp 4257..4294 393..356 109 76.3 Minus

IP21428.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:00:03 Download gff for IP21428.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 218116..218150 1..35 100 -> Plus
chr3L 218238..218618 36..416 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-01-13 14:33:36 Download gff for IP21428.complete
Subject Subject Range Query Range Percent Splice Strand
CG13877-RA 1..324 20..343 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:52:28 Download gff for IP21428.complete
Subject Subject Range Query Range Percent Splice Strand
CG13877-RC 1..324 20..343 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:06:27 Download gff for IP21428.complete
Subject Subject Range Query Range Percent Splice Strand
CG13877-RC 1..324 20..343 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:51:41 Download gff for IP21428.complete
Subject Subject Range Query Range Percent Splice Strand
CG13877-RA 25..324 1..300 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:37:03 Download gff for IP21428.complete
Subject Subject Range Query Range Percent Splice Strand
CG13877-RC 1..324 20..343 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-01-13 14:33:35 Download gff for IP21428.complete
Subject Subject Range Query Range Percent Splice Strand
pyx-RA 3335..3723 27..416 99   Minus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:52:28 Download gff for IP21428.complete
Subject Subject Range Query Range Percent Splice Strand
CG13877-RC 95..510 1..416 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:06:27 Download gff for IP21428.complete
Subject Subject Range Query Range Percent Splice Strand
CG13877-RC 1..416 1..416 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:51:41 Download gff for IP21428.complete
Subject Subject Range Query Range Percent Splice Strand
pyx-RA 3335..3707 1..373 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:37:03 Download gff for IP21428.complete
Subject Subject Range Query Range Percent Splice Strand
CG13877-RC 1..416 1..416 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:00:03 Download gff for IP21428.complete
Subject Subject Range Query Range Percent Splice Strand
3L 218161..218195 1..35 100 -> Plus
3L 218283..218663 36..416 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:00:03 Download gff for IP21428.complete
Subject Subject Range Query Range Percent Splice Strand
3L 218161..218195 1..35 100 -> Plus
3L 218283..218663 36..416 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:00:03 Download gff for IP21428.complete
Subject Subject Range Query Range Percent Splice Strand
3L 218161..218195 1..35 100 -> Plus
3L 218283..218663 36..416 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:06:27 Download gff for IP21428.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 218161..218195 1..35 100 -> Plus
arm_3L 218283..218663 36..416 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:28:39 Download gff for IP21428.complete
Subject Subject Range Query Range Percent Splice Strand
3L 218283..218663 36..416 100   Plus
3L 218161..218195 1..35 100 -> Plus

IP21428.hyp Sequence

Translation from 0 to 342

> IP21428.hyp
FVKLKKMVYICTLVVLIFPVLLLGAPWEGSHPKSQVEYISNDKRVDSGFA
NPNIVPITQPSVVTQTAPPPPPNSKNFAYSPMTQSWTLIAPGDPLPNNDT
LVWNQSNDKWLTR*

IP21428.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:48:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG13877-PC 107 CG13877-PC 1..107 7..113 584 100 Plus
CG13877-PB 108 CG13877-PB 1..108 7..113 572 99.1 Plus

IP21428.pep Sequence

Translation from 1 to 342

> IP21428.pep
FVKLKKMVYICTLVVLIFPVLLLGAPWEGSHPKSQVEYISNDKRVDSGFA
NPNIVPITQPSVVTQTAPPPPPNSKNFAYSPMTQSWTLIAPGDPLPNNDT
LVWNQSNDKWLTR*

IP21428.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:27:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14703-PA 107 GG14703-PA 1..107 7..113 501 89.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:27:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13148-PA 166 GH13148-PA 65..161 10..112 252 54.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:06:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG13877-PC 107 CG13877-PC 1..107 7..113 584 100 Plus
CG13877-PB 108 CG13877-PB 1..108 7..113 572 99.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:27:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17787-PA 107 GI17787-PA 6..102 7..112 248 52.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:27:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16116-PA 113 GL16116-PA 8..110 9..112 337 66.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:27:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12593-PB 108 GA12593-PB 1..105 7..112 331 65.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:27:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14319-PA 107 GM14319-PA 1..107 7..113 534 97.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:27:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13557-PA 107 GD13557-PA 1..107 7..113 528 95.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:27:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17613-PA 107 GJ17613-PA 25..103 30..113 251 64.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:27:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21066-PA 107 GE21066-PA 1..107 7..113 478 86 Plus