BDGP Sequence Production Resources |
Search the DGRC for IP21428
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 214 |
Well: | 28 |
Vector: | pOT2 |
Associated Gene/Transcript | CG13877-RC |
Protein status: | IP21428.pep: gold |
Sequenced Size: | 443 |
Gene | Date | Evidence |
---|---|---|
pyx | 2008-05-05 | Release 5.5 slip selected |
443 bp assembled on 2010-01-13
GenBank Submission: BT032805.2
> IP21428.complete CTTTGTAAAATTAAAGAAAATGGTTTACATATGCACTCTTGTGGTGTTGA TCTTTCCCGTCTTGTTGTTGGGTGCACCATGGGAAGGGTCGCATCCTAAG TCTCAGGTGGAATACATCAGCAACGACAAGAGAGTTGATTCTGGCTTCGC CAACCCCAATATCGTGCCCATCACCCAGCCGTCGGTCGTAACGCAAACAG CTCCTCCTCCGCCGCCAAATTCCAAAAACTTTGCATATAGTCCGATGACG CAGAGCTGGACCCTCATTGCGCCAGGCGATCCGCTGCCCAATAATGACAC CCTCGTCTGGAACCAGAGCAATGACAAATGGCTCACTCGCTAAGCAATGC AACCATCGATGGCTTTGCTTTAATCATTGTGTATTACTATTGAAATAAAT ATAACTAATTCACTGTAAAAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 218238..218618 | 36..416 | 1905 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 218283..218664 | 36..417 | 1910 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
accord | 7404 | accord ACCORD 7404bp | 4257..4294 | 393..356 | 109 | 76.3 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 218116..218150 | 1..35 | 100 | -> | Plus |
chr3L | 218238..218618 | 36..416 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13877-RA | 1..324 | 20..343 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13877-RC | 1..324 | 20..343 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13877-RC | 1..324 | 20..343 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13877-RA | 25..324 | 1..300 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13877-RC | 1..324 | 20..343 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
pyx-RA | 3335..3723 | 27..416 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13877-RC | 95..510 | 1..416 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13877-RC | 1..416 | 1..416 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
pyx-RA | 3335..3707 | 1..373 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13877-RC | 1..416 | 1..416 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 218161..218195 | 1..35 | 100 | -> | Plus |
3L | 218283..218663 | 36..416 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 218161..218195 | 1..35 | 100 | -> | Plus |
3L | 218283..218663 | 36..416 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 218161..218195 | 1..35 | 100 | -> | Plus |
3L | 218283..218663 | 36..416 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 218161..218195 | 1..35 | 100 | -> | Plus |
arm_3L | 218283..218663 | 36..416 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 218283..218663 | 36..416 | 100 | Plus | |
3L | 218161..218195 | 1..35 | 100 | -> | Plus |
Translation from 0 to 342
> IP21428.hyp FVKLKKMVYICTLVVLIFPVLLLGAPWEGSHPKSQVEYISNDKRVDSGFA NPNIVPITQPSVVTQTAPPPPPNSKNFAYSPMTQSWTLIAPGDPLPNNDT LVWNQSNDKWLTR*
Translation from 1 to 342
> IP21428.pep FVKLKKMVYICTLVVLIFPVLLLGAPWEGSHPKSQVEYISNDKRVDSGFA NPNIVPITQPSVVTQTAPPPPPNSKNFAYSPMTQSWTLIAPGDPLPNNDT LVWNQSNDKWLTR*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG14703-PA | 107 | GG14703-PA | 1..107 | 7..113 | 501 | 89.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH13148-PA | 166 | GH13148-PA | 65..161 | 10..112 | 252 | 54.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13877-PC | 107 | CG13877-PC | 1..107 | 7..113 | 584 | 100 | Plus |
CG13877-PB | 108 | CG13877-PB | 1..108 | 7..113 | 572 | 99.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI17787-PA | 107 | GI17787-PA | 6..102 | 7..112 | 248 | 52.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL16116-PA | 113 | GL16116-PA | 8..110 | 9..112 | 337 | 66.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12593-PB | 108 | GA12593-PB | 1..105 | 7..112 | 331 | 65.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM14319-PA | 107 | GM14319-PA | 1..107 | 7..113 | 534 | 97.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD13557-PA | 107 | GD13557-PA | 1..107 | 7..113 | 528 | 95.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ17613-PA | 107 | GJ17613-PA | 25..103 | 30..113 | 251 | 64.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE21066-PA | 107 | GE21066-PA | 1..107 | 7..113 | 478 | 86 | Plus |