Clone IP21433 Report

Search the DGRC for IP21433

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:214
Well:33
Vector:pOT2
Protein status:IP21433.pep: Imported from assembly
Sequenced Size:1023

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2059 2008-05-05 Release 5.5 slip selected

Clone Sequence Records

IP21433.complete Sequence

1023 bp assembled on 2009-04-10

GenBank Submission: BT082026.1

> IP21433.complete
CGGCACGAGGCAGCGCCTGACGAAATCGTTACGTTCACTTCCATTTCCCG
CGGGAAAGATCCTGCGAACCCAATTGGTGGTCAGAAGGGAGTACTCCTCG
GAAATACCGGATCCCGTTGAACTAAGCTTCGATTCGTACACCGGCGAGAA
TCCAGAGACGAGTCCACCACTGCTCACATATCATGGACTCTTTGGTTCCA
AGCAAAATTGGCGAGGAATTAGCAAGGCTCTGGTGCGAAAAGTTTCCCGA
AAGGTGTACGCCATCGATGTGAGGAATCATGGCGAGAGTCCACATTCGAG
TGTCCACAATTCCAAAGCGATGAGCGAGGATTTGCGTTTGTTTATGGAGC
AGCGCAGTCATCCGAATGCCGCCTGCATGGGTCACAGCATGGGCGGCAGG
TCCATGATGTACTTCGCTCGAAAATATCCCGAGTTGGTGGAACGTTTGAT
AGTGGTGGACATATCGCCAATTAGCGTGCCCCGTTCCACGGGCGAGATGA
CGGAAATTTTCGACGCGATGGTCTCCCTGGACCTTTCGCCAAGCATGTCC
ATGTCTGAGGGCAGGAAAATTGCACGGGAAAAACTACTGAAAGCCACCGA
AGACGAGACCGTTGACTTTATCATGCTGAATCTCCGAAAAAATCCTGACA
CCGGCGCTTTCTCTTGGGCCTGCAATGCCCATGTTCTTCGTGAATTCCTC
ACCCGCTTCGACAAATATCAGAGTAATTTGGAGGAACTGCCGCCGTACAC
GGGACCCACTACGTTCATTTGCGGCACGCGATCACCTTACATGAGACGCG
AGCAATGGCCACAGATACAGAAAATGTTTCCCAATTCTGAGATCCACTGG
CTGGATGCCGGACATTTAGTGCACTTTGAAAAGCCGCAGGAGTTTCTAAC
AATAGTCAGCGAGTTCCTGAATAGAACTGAGTAGACCAAATTTTGATATT
TTAACCAAATGTACAAAGAAGTCAATCGCGTAGATCGACTTTAGCTAAAT
TGAAAAAAAAAAAAAAAAAAAAA

IP21433.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:30:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG2059-RA 1386 CG2059-RA 281..1277 10..1006 4970 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:33:05
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 7178786..7179032 10..256 1235 100 Plus
chrX 22417052 chrX 7179338..7179571 424..657 1155 99.6 Plus
chrX 22417052 chrX 7179840..7180048 794..1002 1045 100 Plus
chrX 22417052 chrX 7179101..7179276 252..427 880 100 Plus
chrX 22417052 chrX 7179640..7179777 658..795 690 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:45:36 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:33:04
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7286855..7287101 10..256 1235 100 Plus
X 23542271 X 7287407..7287640 424..657 1155 99.6 Plus
X 23542271 X 7287909..7288121 794..1006 1050 99.5 Plus
X 23542271 X 7287170..7287345 252..427 880 100 Plus
X 23542271 X 7287709..7287846 658..795 690 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:46:52
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 7294953..7295199 10..256 1235 100 Plus
X 23527363 X 7295505..7295738 424..657 1155 99.5 Plus
X 23527363 X 7296007..7296219 794..1006 1050 99.5 Plus
X 23527363 X 7295268..7295443 252..427 880 100 Plus
X 23527363 X 7295807..7295944 658..795 690 100 Plus
Blast to na_te.dros performed on 2019-03-16 18:33:04 has no hits.

IP21433.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:33:42 Download gff for IP21433.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 7178781..7179029 4..253 98 -> Plus
chrX 7179103..7179276 254..427 100 -> Plus
chrX 7179342..7179571 428..657 100 -> Plus
chrX 7179640..7179777 658..795 100 -> Plus
chrX 7179842..7180048 796..1002 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:09:14 Download gff for IP21433.complete
Subject Subject Range Query Range Percent Splice Strand
CG2059-RA 1..927 8..934 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:45:20 Download gff for IP21433.complete
Subject Subject Range Query Range Percent Splice Strand
CG2059-RB 1..927 8..934 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:49:36 Download gff for IP21433.complete
Subject Subject Range Query Range Percent Splice Strand
CG2059-RA 1..927 8..934 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:42:42 Download gff for IP21433.complete
Subject Subject Range Query Range Percent Splice Strand
CG2059-RA 1..927 8..934 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-04-10 11:29:48 Download gff for IP21433.complete
Subject Subject Range Query Range Percent Splice Strand
CG2059-RA 1..927 8..934 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:45:19 Download gff for IP21433.complete
Subject Subject Range Query Range Percent Splice Strand
CG2059-RB 144..1141 4..1002 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:49:36 Download gff for IP21433.complete
Subject Subject Range Query Range Percent Splice Strand
CG2059-RA 200..1197 4..1002 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:42:42 Download gff for IP21433.complete
Subject Subject Range Query Range Percent Splice Strand
CG2059-RA 200..1197 4..1002 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:33:42 Download gff for IP21433.complete
Subject Subject Range Query Range Percent Splice Strand
X 7286850..7287098 4..253 98 -> Plus
X 7287172..7287345 254..427 100 -> Plus
X 7287411..7287640 428..657 100 -> Plus
X 7287709..7287846 658..795 100 -> Plus
X 7287911..7288117 796..1002 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:33:42 Download gff for IP21433.complete
Subject Subject Range Query Range Percent Splice Strand
X 7286850..7287098 4..253 98 -> Plus
X 7287172..7287345 254..427 100 -> Plus
X 7287411..7287640 428..657 100 -> Plus
X 7287709..7287846 658..795 100 -> Plus
X 7287911..7288117 796..1002 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:33:42 Download gff for IP21433.complete
Subject Subject Range Query Range Percent Splice Strand
X 7286850..7287098 4..253 98 -> Plus
X 7287172..7287345 254..427 100 -> Plus
X 7287411..7287640 428..657 100 -> Plus
X 7287709..7287846 658..795 100 -> Plus
X 7287911..7288117 796..1002 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:49:36 Download gff for IP21433.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 7181444..7181673 428..657 100 -> Plus
arm_X 7181742..7181879 658..795 100 -> Plus
arm_X 7181944..7182150 796..1002 100   Plus
arm_X 7180883..7181131 4..253 98 -> Plus
arm_X 7181205..7181378 254..427 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:20:35 Download gff for IP21433.complete
Subject Subject Range Query Range Percent Splice Strand
X 7294948..7295196 4..253 98 -> Plus
X 7295270..7295443 254..427 100 -> Plus
X 7295509..7295738 428..657 100 -> Plus
X 7295807..7295944 658..795 100 -> Plus
X 7296009..7296215 796..1002 100   Plus

IP21433.pep Sequence

Translation from 1 to 933

> IP21433.pep
GTRQRLTKSLRSLPFPAGKILRTQLVVRREYSSEIPDPVELSFDSYTGEN
PETSPPLLTYHGLFGSKQNWRGISKALVRKVSRKVYAIDVRNHGESPHSS
VHNSKAMSEDLRLFMEQRSHPNAACMGHSMGGRSMMYFARKYPELVERLI
VVDISPISVPRSTGEMTEIFDAMVSLDLSPSMSMSEGRKIAREKLLKATE
DETVDFIMLNLRKNPDTGAFSWACNAHVLREFLTRFDKYQSNLEELPPYT
GPTTFICGTRSPYMRREQWPQIQKMFPNSEIHWLDAGHLVHFEKPQEFLT
IVSEFLNRTE*

IP21433.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:27:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19711-PA 306 GF19711-PA 26..306 25..309 1047 66.3 Plus
Dana\GF18391-PA 297 GF18391-PA 15..295 29..305 419 33 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:27:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19637-PA 312 GG19637-PA 2..312 4..310 1507 89.1 Plus
Dere\GG18366-PA 307 GG18366-PA 2..300 2..305 411 32 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:27:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24258-PA 324 GH24258-PA 22..323 7..308 872 51.6 Plus
Dgri\GH18268-PA 325 GH18268-PA 44..316 37..305 395 33 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:50:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG2059-PB 308 CG2059-PB 2..308 4..310 1610 100 Plus
CG2059-PA 308 CG2059-PA 2..308 4..310 1610 100 Plus
CG14717-PB 306 CG14717-PB 31..299 41..305 379 33.7 Plus
CG14717-PA 306 CG14717-PA 31..299 41..305 379 33.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:27:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15943-PA 317 GI15943-PA 2..315 4..307 891 52.2 Plus
Dmoj\GI24075-PA 298 GI24075-PA 18..288 41..305 443 34.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 16:27:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14693-PA 319 GL14693-PA 33..314 26..308 1049 66 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:27:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15213-PA 319 GA15213-PA 33..314 26..308 1040 65.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:27:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17512-PA 308 GM17512-PA 2..307 4..309 1573 95.8 Plus
Dsec\GM23971-PA 306 GM23971-PA 2..299 2..305 402 33.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:27:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24762-PA 190 GD24762-PA 29..190 149..310 846 95.7 Plus
Dsim\GD18776-PA 306 GD18776-PA 2..299 2..305 410 32.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:27:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14849-PA 322 GJ14849-PA 27..320 14..307 850 50.5 Plus
Dvir\GJ10894-PA 278 GJ10894-PA 15..269 54..305 432 37.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:27:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16216-PA 313 GK16216-PA 28..312 29..308 1005 62.5 Plus
Dwil\GK19111-PA 308 GK19111-PA 15..303 28..310 541 37.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:27:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15707-PA 280 GE15707-PA 16..280 46..310 1346 91.3 Plus
Dyak\GE24195-PA 307 GE24195-PA 2..300 2..305 428 33.8 Plus

IP21433.hyp Sequence

Translation from 4 to 933

> IP21433.hyp
QMQRLTKSLRSLPFPAGKILRTQLVVRREYSSEIPDPVELSFDSYTGENP
ETSPPLLTYHGLFGSKQNWRGISKALVRKVSRKVYAIDVRNHGESPHSSV
HNSKAMSEDLRLFMEQRSHPNAACMGHSMGGRSMMYFARKYPELVERLIV
VDISPISVPRSTGEMTEIFDAMVSLDLSPSMSMSEGRKIAREKLLKATED
ETVDFIMLNLRKNPDTGAFSWACNAHVLREFLTRFDKYQSNLEELPPYTG
PTTFICGTRSPYMRREQWPQIQKMFPNSEIHWLDAGHLVHFEKPQEFLTI
VSEFLNRTE*

IP21433.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:21:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG2059-PB 308 CG2059-PB 1..308 2..309 1615 100 Plus
CG2059-PA 308 CG2059-PA 1..308 2..309 1615 100 Plus
CG14717-PB 306 CG14717-PB 31..299 40..304 379 33.7 Plus
CG14717-PA 306 CG14717-PA 31..299 40..304 379 33.7 Plus