Clone IP21451 Report

Search the DGRC for IP21451

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:214
Well:51
Vector:pOT2
Associated Gene/TranscriptCG4783-RA
Protein status:IP21451.pep: gold
Sequenced Size:398

Clone Sequence Records

IP21451.complete Sequence

398 bp assembled on 2009-06-08

GenBank Submission: BT088779.1

> IP21451.complete
CCGACACCTACGACATGAACTGGGCTACCATAATAATTGCAATTATCCTC
CTGCTGCCAGCCAGCCAGCAAAGCTTTATTAGATCCGAAAGTGTGGAGGT
CAAAGTGCTGTCTTACAATCCCACATACGATTTCTGGTTTTTCATGCCAA
CTGGCAGACCCAAGGTGGTTACTCAGAATGTACAGAATGCATATTGGTCT
GCTCGGACAAAAGGAGGTGTTTGCTTCACAGATCTGTGGTTCTACTGCGC
AACTGGCATCGAAATAGAGGAGTAAATATCTTGGCAACAAAGGAACACAA
ACTATGTATATTTGAAGATTTGTTACACCCATTCATTAAAACAAGAAAAT
AAATAATCTGCGTAACGTTTACACGAAAACCTAAAAAAAAAAAAAAAA

IP21451.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:31:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG4783-RA 603 CG4783-RA 129..513 1..385 1925 100 Plus
CG4783.a 454 CG4783.a 127..431 81..385 1525 100 Plus
CG4783.a 454 CG4783.a 56..128 1..73 365 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:07:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 15772508..15772819 71..382 1560 100 Plus
chr3R 27901430 chr3R 15772383..15772455 1..73 365 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:45:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:07:41
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 19948596..19948910 71..385 1575 100 Plus
3R 32079331 3R 19948471..19948543 1..73 365 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:47:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 19689427..19689741 71..385 1575 100 Plus
3R 31820162 3R 19689302..19689374 1..73 365 100 Plus
Blast to na_te.dros performed 2019-03-15 15:07:42
Subject Length Description Subject Range Query Range Score Percent Strand
Tabor 7345 Tabor TABOR 7345bp 6413..6500 275..360 113 64.1 Plus

IP21451.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:08:35 Download gff for IP21451.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 15772383..15772455 1..73 100 -> Plus
chr3R 15772511..15772819 74..382 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:10:04 Download gff for IP21451.complete
Subject Subject Range Query Range Percent Splice Strand
CG4783-RA 1..261 15..275 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:47:01 Download gff for IP21451.complete
Subject Subject Range Query Range Percent Splice Strand
CG4783-RA 1..261 15..275 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:03:48 Download gff for IP21451.complete
Subject Subject Range Query Range Percent Splice Strand
CG4783-RA 1..261 15..275 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:28:07 Download gff for IP21451.complete
Subject Subject Range Query Range Percent Splice Strand
CG4783-RA 1..261 15..275 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-06-08 13:45:59 Download gff for IP21451.complete
Subject Subject Range Query Range Percent Splice Strand
CG4783-RA 2..383 1..382 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:47:01 Download gff for IP21451.complete
Subject Subject Range Query Range Percent Splice Strand
CG4783-RA 2..383 1..382 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:03:48 Download gff for IP21451.complete
Subject Subject Range Query Range Percent Splice Strand
CG4783-RA 2..383 1..382 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:28:07 Download gff for IP21451.complete
Subject Subject Range Query Range Percent Splice Strand
CG4783-RA 29..410 1..382 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:08:35 Download gff for IP21451.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19948471..19948543 1..73 100 -> Plus
3R 19948599..19948907 74..382 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:08:35 Download gff for IP21451.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19948471..19948543 1..73 100 -> Plus
3R 19948599..19948907 74..382 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:08:35 Download gff for IP21451.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19948471..19948543 1..73 100 -> Plus
3R 19948599..19948907 74..382 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:03:48 Download gff for IP21451.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 15774193..15774265 1..73 100 -> Plus
arm_3R 15774321..15774629 74..382 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:22:26 Download gff for IP21451.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19689430..19689738 74..382 100   Plus
3R 19689302..19689374 1..73 100 -> Plus

IP21451.hyp Sequence

Translation from 2 to 274

> IP21451.hyp
DTYDMNWATIIIAIILLLPASQQSFIRSESVEVKVLSYNPTYDFWFFMPT
GRPKVVTQNVQNAYWSARTKGGVCFTDLWFYCATGIEIEE*

IP21451.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:21:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG4783-PA 86 CG4783-PA 1..86 5..90 462 100 Plus
CG4783-PB 83 CG4783-PB 1..83 5..90 434 96.5 Plus

IP21451.pep Sequence

Translation from 2 to 274

> IP21451.pep
DTYDMNWATIIIAIILLLPASQQSFIRSESVEVKVLSYNPTYDFWFFMPT
GRPKVVTQNVQNAYWSARTKGGVCFTDLWFYCATGIEIEE*

IP21451.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:46:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17629-PA 84 GF17629-PA 5..84 8..90 254 57.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:46:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23625-PA 84 GG23625-PA 1..84 5..90 324 82.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:08:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG4783-PA 86 CG4783-PA 1..86 5..90 462 100 Plus
CG4783-PB 83 CG4783-PB 1..83 5..90 434 96.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:46:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18428-PB 87 GA18428-PB 5..85 9..90 163 41.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:46:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26876-PA 37 GM26876-PA 1..37 5..41 174 91.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:46:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19324-PA 86 GD19324-PA 1..86 5..90 438 91.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:46:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11000-PA 86 GJ11000-PA 1..86 5..90 187 43.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:46:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11213-PA 83 GE11213-PA 1..83 5..90 352 88.4 Plus
Dyak\GE25637-PA 83 GE25637-PA 1..83 5..90 344 87.2 Plus