IP21451.complete Sequence
398 bp assembled on 2009-06-08
GenBank Submission: BT088779.1
> IP21451.complete
CCGACACCTACGACATGAACTGGGCTACCATAATAATTGCAATTATCCTC
CTGCTGCCAGCCAGCCAGCAAAGCTTTATTAGATCCGAAAGTGTGGAGGT
CAAAGTGCTGTCTTACAATCCCACATACGATTTCTGGTTTTTCATGCCAA
CTGGCAGACCCAAGGTGGTTACTCAGAATGTACAGAATGCATATTGGTCT
GCTCGGACAAAAGGAGGTGTTTGCTTCACAGATCTGTGGTTCTACTGCGC
AACTGGCATCGAAATAGAGGAGTAAATATCTTGGCAACAAAGGAACACAA
ACTATGTATATTTGAAGATTTGTTACACCCATTCATTAAAACAAGAAAAT
AAATAATCTGCGTAACGTTTACACGAAAACCTAAAAAAAAAAAAAAAA
IP21451.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:31:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG4783-RA | 603 | CG4783-RA | 129..513 | 1..385 | 1925 | 100 | Plus |
CG4783.a | 454 | CG4783.a | 127..431 | 81..385 | 1525 | 100 | Plus |
CG4783.a | 454 | CG4783.a | 56..128 | 1..73 | 365 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:07:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 15772508..15772819 | 71..382 | 1560 | 100 | Plus |
chr3R | 27901430 | chr3R | 15772383..15772455 | 1..73 | 365 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:45:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:07:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 19948596..19948910 | 71..385 | 1575 | 100 | Plus |
3R | 32079331 | 3R | 19948471..19948543 | 1..73 | 365 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:47:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 19689427..19689741 | 71..385 | 1575 | 100 | Plus |
3R | 31820162 | 3R | 19689302..19689374 | 1..73 | 365 | 100 | Plus |
Blast to na_te.dros performed 2019-03-15 15:07:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Tabor | 7345 | Tabor TABOR 7345bp | 6413..6500 | 275..360 | 113 | 64.1 | Plus |
IP21451.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:08:35 Download gff for
IP21451.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 15772383..15772455 | 1..73 | 100 | -> | Plus |
chr3R | 15772511..15772819 | 74..382 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:10:04 Download gff for
IP21451.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG4783-RA | 1..261 | 15..275 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:47:01 Download gff for
IP21451.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG4783-RA | 1..261 | 15..275 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:03:48 Download gff for
IP21451.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG4783-RA | 1..261 | 15..275 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:28:07 Download gff for
IP21451.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG4783-RA | 1..261 | 15..275 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-06-08 13:45:59 Download gff for
IP21451.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG4783-RA | 2..383 | 1..382 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:47:01 Download gff for
IP21451.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG4783-RA | 2..383 | 1..382 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:03:48 Download gff for
IP21451.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG4783-RA | 2..383 | 1..382 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:28:07 Download gff for
IP21451.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG4783-RA | 29..410 | 1..382 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:08:35 Download gff for
IP21451.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 19948471..19948543 | 1..73 | 100 | -> | Plus |
3R | 19948599..19948907 | 74..382 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:08:35 Download gff for
IP21451.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 19948471..19948543 | 1..73 | 100 | -> | Plus |
3R | 19948599..19948907 | 74..382 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:08:35 Download gff for
IP21451.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 19948471..19948543 | 1..73 | 100 | -> | Plus |
3R | 19948599..19948907 | 74..382 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:03:48 Download gff for
IP21451.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 15774193..15774265 | 1..73 | 100 | -> | Plus |
arm_3R | 15774321..15774629 | 74..382 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:22:26 Download gff for
IP21451.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 19689430..19689738 | 74..382 | 100 | | Plus |
3R | 19689302..19689374 | 1..73 | 100 | -> | Plus |
IP21451.hyp Sequence
Translation from 2 to 274
> IP21451.hyp
DTYDMNWATIIIAIILLLPASQQSFIRSESVEVKVLSYNPTYDFWFFMPT
GRPKVVTQNVQNAYWSARTKGGVCFTDLWFYCATGIEIEE*
IP21451.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:21:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG4783-PA | 86 | CG4783-PA | 1..86 | 5..90 | 462 | 100 | Plus |
CG4783-PB | 83 | CG4783-PB | 1..83 | 5..90 | 434 | 96.5 | Plus |
IP21451.pep Sequence
Translation from 2 to 274
> IP21451.pep
DTYDMNWATIIIAIILLLPASQQSFIRSESVEVKVLSYNPTYDFWFFMPT
GRPKVVTQNVQNAYWSARTKGGVCFTDLWFYCATGIEIEE*
IP21451.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:46:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF17629-PA | 84 | GF17629-PA | 5..84 | 8..90 | 254 | 57.8 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:46:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG23625-PA | 84 | GG23625-PA | 1..84 | 5..90 | 324 | 82.6 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:08:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG4783-PA | 86 | CG4783-PA | 1..86 | 5..90 | 462 | 100 | Plus |
CG4783-PB | 83 | CG4783-PB | 1..83 | 5..90 | 434 | 96.5 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:46:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA18428-PB | 87 | GA18428-PB | 5..85 | 9..90 | 163 | 41.9 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:46:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM26876-PA | 37 | GM26876-PA | 1..37 | 5..41 | 174 | 91.9 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:46:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD19324-PA | 86 | GD19324-PA | 1..86 | 5..90 | 438 | 91.9 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:46:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ11000-PA | 86 | GJ11000-PA | 1..86 | 5..90 | 187 | 43.3 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:46:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE11213-PA | 83 | GE11213-PA | 1..83 | 5..90 | 352 | 88.4 | Plus |
Dyak\GE25637-PA | 83 | GE25637-PA | 1..83 | 5..90 | 344 | 87.2 | Plus |