Clone IP21458 Report

Search the DGRC for IP21458

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:214
Well:58
Vector:pOT2
Associated Gene/TranscriptObp84a-RA
Protein status:IP21458.pep: gold
Sequenced Size:667

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10050 2008-05-05 Release 5.5 slip selected
Pbprp4 2008-08-15 Release 5.9 accounting
Pbprp4 2008-12-18 5.12 accounting

Clone Sequence Records

IP21458.complete Sequence

667 bp assembled on 2008-05-14

GenBank Submission: BT032807

> IP21458.complete
ATGTATTCCGCGTTAGTTAGAGCTTGTGCTGTCATTGCTTTTCTGATCTT
GAGCCCGAATTGTGCCAGGGCTCTACAGGATCACGCCAAGGATAATGGTG
ATATTTTCATCATAAACTATGATAGTTTCGATGGCGATGTGGATGACATA
TCCACCACCACTTCAGCTCCTAGAGAGGCTGACTACGTAGATTTTGACGA
GGTTAATCGTAACTGCAATGCTAGTTTCATAACGTCGATGACCAATGTCT
TGCAGTTTAATAACACTGGGGATTTGCCAGATGACAAGGATAAGGTAACC
AGCATGTGCTATTTTCACTGCTTTTTCGAAAAGTCCGGTTTGATGACGGA
CTATAAGTTAAATACGGATCTGGTGCGCAAATATGTTTGGCCAGCCACTG
GCGATTCCGTTGAGGCCTGCGAAGCTGAAGGCAAGGACGAGACGAATGCT
TGCATGCGGGGCTATGCCATCGTCAAGTGCGTGTTTACTAGAGCCCTCAC
GGATGCTAGAAACAAACCCACTGTATGAATAACATCAAAGGTCACATCTC
GGACTTATCAGTAGAAAATTATAATGTTAGCGTCACTAAATCAAATACGG
CTACGACCGGAACACAAAATTGGCTATAAAGCACAGGCACCTGCAAAAAA
AAAAAAAAAAAAAAAAA

IP21458.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:57:45
Subject Length Description Subject Range Query Range Score Percent Strand
Pbprp4-RA 579 Pbprp4-RA 20..579 1..560 2800 100 Plus
Pbprp4-RC 698 Pbprp4-RC 154..698 16..560 2725 100 Plus
CG10050-RA 1965 CG10050-RA 1486..1726 241..1 1205 100 Minus
CG10050-RA 1965 CG10050-RA 913..1125 646..434 1065 100 Minus
CG10050-RA 1965 CG10050-RA 1186..1313 433..306 640 100 Minus
CG10050-RA 1965 CG10050-RA 1366..1430 306..242 325 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:49:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 3077380..3077620 241..1 1205 100 Minus
chr3R 27901430 chr3R 3076809..3077019 644..434 1055 100 Minus
chr3R 27901430 chr3R 3077080..3077207 433..306 640 100 Minus
chr3R 27901430 chr3R 3077260..3077324 306..242 325 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:45:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:49:44
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 7251296..7251536 241..1 1205 100 Minus
3R 32079331 3R 7250723..7250935 646..434 1065 100 Minus
3R 32079331 3R 7250996..7251123 433..306 640 100 Minus
3R 32079331 3R 7251176..7251240 306..242 325 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:54:04
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 6992127..6992367 241..1 1205 100 Minus
3R 31820162 3R 6991554..6991766 646..434 1065 100 Minus
3R 31820162 3R 6991827..6991954 433..306 640 100 Minus
3R 31820162 3R 6992007..6992071 306..242 325 100 Minus
Blast to na_te.dros performed on 2019-03-16 16:49:44 has no hits.

IP21458.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:50:32 Download gff for IP21458.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 3076809..3077019 434..644 100 <- Minus
chr3R 3077080..3077206 307..433 100 <- Minus
chr3R 3077260..3077324 242..306 100 <- Minus
chr3R 3077380..3077620 1..241 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:25:35 Download gff for IP21458.complete
Subject Subject Range Query Range Percent Splice Strand
Pbprp4-RA 1..528 1..528 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:51:12 Download gff for IP21458.complete
Subject Subject Range Query Range Percent Splice Strand
Pbprp4-RA 1..528 1..528 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:24:33 Download gff for IP21458.complete
Subject Subject Range Query Range Percent Splice Strand
Obp84a-RA 1..528 1..528 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:50:26 Download gff for IP21458.complete
Subject Subject Range Query Range Percent Splice Strand
Pbprp4-RA 1..528 1..528 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:44:44 Download gff for IP21458.complete
Subject Subject Range Query Range Percent Splice Strand
Obp84a-RA 1..528 1..528 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:14:12 Download gff for IP21458.complete
Subject Subject Range Query Range Percent Splice Strand
Pbprp4-RA 20..579 1..560 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:51:12 Download gff for IP21458.complete
Subject Subject Range Query Range Percent Splice Strand
Pbprp4-RA 20..579 1..560 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:24:33 Download gff for IP21458.complete
Subject Subject Range Query Range Percent Splice Strand
Obp84a-RA 20..663 1..644 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:50:27 Download gff for IP21458.complete
Subject Subject Range Query Range Percent Splice Strand
Pbprp4-RA 20..579 1..560 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:44:44 Download gff for IP21458.complete
Subject Subject Range Query Range Percent Splice Strand
Obp84a-RA 20..663 1..644 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:50:32 Download gff for IP21458.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7250725..7250935 434..644 100 <- Minus
3R 7250996..7251122 307..433 100 <- Minus
3R 7251176..7251240 242..306 100 <- Minus
3R 7251296..7251536 1..241 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:50:32 Download gff for IP21458.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7250725..7250935 434..644 100 <- Minus
3R 7250996..7251122 307..433 100 <- Minus
3R 7251176..7251240 242..306 100 <- Minus
3R 7251296..7251536 1..241 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:50:32 Download gff for IP21458.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7250725..7250935 434..644 100 <- Minus
3R 7250996..7251122 307..433 100 <- Minus
3R 7251176..7251240 242..306 100 <- Minus
3R 7251296..7251536 1..241 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:24:33 Download gff for IP21458.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 3077018..3077258 1..241 100   Minus
arm_3R 3076447..3076657 434..644 100 <- Minus
arm_3R 3076718..3076844 307..433 100 <- Minus
arm_3R 3076898..3076962 242..306 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:29:31 Download gff for IP21458.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6992127..6992367 1..241 100   Minus
3R 6991556..6991766 434..644 100 <- Minus
3R 6991827..6991953 307..433 100 <- Minus
3R 6992007..6992071 242..306 100 <- Minus

IP21458.pep Sequence

Translation from 0 to 527

> IP21458.pep
MYSALVRACAVIAFLILSPNCARALQDHAKDNGDIFIINYDSFDGDVDDI
STTTSAPREADYVDFDEVNRNCNASFITSMTNVLQFNNTGDLPDDKDKVT
SMCYFHCFFEKSGLMTDYKLNTDLVRKYVWPATGDSVEACEAEGKDETNA
CMRGYAIVKCVFTRALTDARNKPTV*

IP21458.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:18:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17311-PA 170 GF17311-PA 1..170 1..175 705 76.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:18:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25271-PA 209 GG25271-PA 40..209 6..175 842 92.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:18:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19282-PA 174 GH19282-PA 1..174 1..175 556 61.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:12:20
Subject Length Description Subject Range Query Range Score Percent Strand
Obp84a-PA 175 CG1176-PA 1..175 1..175 934 100 Plus
Obp84a-PC 221 CG1176-PC 52..221 6..175 910 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:18:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23493-PA 171 GI23493-PA 5..171 8..175 595 65.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:18:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12188-PA 174 GL12188-PA 1..174 1..175 700 76 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:18:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Obp84a-PA 174 GA11179-PA 1..174 1..175 679 74.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:18:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10493-PA 175 GM10493-PA 1..175 1..175 895 97.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:18:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Obp84a-PA 221 GD19490-PA 52..221 6..175 862 95.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:18:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Obp84a-PA 174 GJ10244-PA 1..174 1..175 592 62.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:18:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11087-PA 201 GK11087-PA 38..201 14..175 561 63.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:18:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25801-PA 175 GE25801-PA 1..175 1..175 859 92 Plus

IP21458.hyp Sequence

Translation from 1 to 527

> IP21458.hyp
MYSALVRACAVIAFLILSPNCARALQDHAKDNGDIFIINYDSFDGDVDDI
STTTSAPREADYVDFDEVNRNCNASFITSMTNVLQFNNTGDLPDDKDKVT
SMCYFHCFFEKSGLMTDYKLNTDLVRKYVWPATGDSVEACEAEGKDETNA
CMRGYAIVKCVFTRALTDARNKPTV*

IP21458.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:21:38
Subject Length Description Subject Range Query Range Score Percent Strand
Obp84a-PA 175 CG1176-PA 1..175 1..175 934 100 Plus
Obp84a-PC 221 CG1176-PC 52..221 6..175 910 100 Plus