Clone IP21465 Report

Search the DGRC for IP21465

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:214
Well:65
Vector:pOT2
Associated Gene/TranscriptCG34051-RA
Protein status:IP21465.pep: gold
Sequenced Size:787

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34051 2008-05-05 Release 5.5 slip selected
CG34051 2008-08-15 Release 5.9 accounting
CG34051 2008-12-18 5.12 accounting

Clone Sequence Records

IP21465.complete Sequence

787 bp assembled on 2008-05-14

GenBank Submission: BT032981

> IP21465.complete
AGCCATGGGACCAAGGCTCTATCCCGCTGCGATCCTCATCCTCCATTGCC
TGCTGTTGCTCTTCCTCCAGGTGGACAGCAGAGGTAACCAGAACCACACC
CAGATGGAAAGACAGCGTCATCTCCGAGCACACAATCTGCACAGGCCTCC
ATACGATGGATACGATTGGCACAAACACTTTAACCGAGATGCCGAACCAA
AGGCGACAGTTGCAAAGGAGAAAGAAGAGAAGACTTTCAAACACAGATCA
GGACATTTAAAAAAGATGAAGCAGACAGCTAGGGATATTTCGAACTGGAG
CAGAGCTCGGAGCGCCTACCAAAAAGAGACGGCAGAGCTGGAGGAATGGG
GTCGAAAGAAGAATATAACTGACAACGAACTGAAGTTATTCTTTGACGGT
GAAATTTCTACCAAAGACAAGTACAGATTATTTGGGGACATTCAAACGGT
TGTCCAGATCCTGAAAGAGGTGATAAAAAAGGGAGCTGTGACCGAAAAAG
AGAAAGCAATGATAACGCCGGAACTGAAACCATTGATCTTAAGATTCGGC
CGCATGTTTGAAAGGGAATTTGCCAAGAACACAAATGCCTTGGAAGCCTT
GCAGATCCTTGTTCATGAGGTTCAAAAATCGAACAGCCGGAACATGAGAC
ATAAGAGTGCTAAAAGGTCTCACTAAGTGGTAATTAAATTGGCTATGCCT
GTGGCGATTTTAGTAACGAAAAGTTTGTAATCTACACACTAAAAGGTCTG
TTAATAAATCGAATAACAATCAAAAAAAAAAAAAAAA

IP21465.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:00:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG34051-RA 789 CG34051-RA 19..789 1..771 3855 100 Plus
CG34051.a 786 CG34051.a 19..786 1..771 3785 99.6 Plus
CG10664-RA 908 CG10664-RA 819..908 772..683 450 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:57:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 19958409..19958690 771..490 1395 99.6 Minus
chr2L 23010047 chr2L 19958744..19958935 490..299 945 99.5 Minus
chr2L 23010047 chr2L 19959194..19959370 177..1 885 100 Minus
chr2L 23010047 chr2L 19958999..19959121 300..178 615 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:45:41 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:57:42
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19960068..19960350 772..490 1415 100 Minus
2L 23513712 2L 19960404..19960595 490..299 960 100 Minus
2L 23513712 2L 19960854..19961030 177..1 885 100 Minus
2L 23513712 2L 19960659..19960781 300..178 615 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:56:16
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19960068..19960350 772..490 1415 100 Minus
2L 23513712 2L 19960404..19960595 490..299 960 100 Minus
2L 23513712 2L 19960854..19961030 177..1 885 100 Minus
2L 23513712 2L 19960659..19960781 300..178 615 100 Minus
Blast to na_te.dros performed 2019-03-16 06:57:43
Subject Length Description Subject Range Query Range Score Percent Strand
Tabor 7345 Tabor TABOR 7345bp 4781..4839 419..360 108 66.7 Minus

IP21465.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:58:34 Download gff for IP21465.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 19958409..19958690 490..771 99 <- Minus
chr2L 19958745..19958933 301..489 99 <- Minus
chr2L 19958999..19959121 178..300 100 <- Minus
chr2L 19959194..19959370 1..177 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:25:38 Download gff for IP21465.complete
Subject Subject Range Query Range Percent Splice Strand
CG34051-RA 1..672 5..676 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:56:18 Download gff for IP21465.complete
Subject Subject Range Query Range Percent Splice Strand
CG34051-RA 1..672 5..676 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:58:58 Download gff for IP21465.complete
Subject Subject Range Query Range Percent Splice Strand
CG34051-RA 1..672 5..676 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:55:40 Download gff for IP21465.complete
Subject Subject Range Query Range Percent Splice Strand
CG34051-RA 1..672 5..676 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:23:39 Download gff for IP21465.complete
Subject Subject Range Query Range Percent Splice Strand
CG34051-RA 1..672 5..676 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:20:42 Download gff for IP21465.complete
Subject Subject Range Query Range Percent Splice Strand
CG34051-RA 1..672 5..676 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:56:18 Download gff for IP21465.complete
Subject Subject Range Query Range Percent Splice Strand
CG34051-RA 1..771 1..771 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:58:58 Download gff for IP21465.complete
Subject Subject Range Query Range Percent Splice Strand
CG34051-RA 1..771 1..771 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:55:40 Download gff for IP21465.complete
Subject Subject Range Query Range Percent Splice Strand
CG34051-RA 1..672 5..676 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:23:39 Download gff for IP21465.complete
Subject Subject Range Query Range Percent Splice Strand
CG34051-RA 1..771 1..771 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:58:34 Download gff for IP21465.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19960069..19960350 490..771 100 <- Minus
2L 19960405..19960593 301..489 100 <- Minus
2L 19960659..19960781 178..300 100 <- Minus
2L 19960854..19961030 1..177 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:58:34 Download gff for IP21465.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19960069..19960350 490..771 100 <- Minus
2L 19960405..19960593 301..489 100 <- Minus
2L 19960659..19960781 178..300 100 <- Minus
2L 19960854..19961030 1..177 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:58:34 Download gff for IP21465.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19960069..19960350 490..771 100 <- Minus
2L 19960405..19960593 301..489 100 <- Minus
2L 19960659..19960781 178..300 100 <- Minus
2L 19960854..19961030 1..177 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:58:58 Download gff for IP21465.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19960659..19960781 178..300 100 <- Minus
arm_2L 19960854..19961030 1..177 100   Minus
arm_2L 19960069..19960350 490..771 100 <- Minus
arm_2L 19960405..19960593 301..489 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:33:05 Download gff for IP21465.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19960069..19960350 490..771 100 <- Minus
2L 19960405..19960593 301..489 100 <- Minus
2L 19960659..19960781 178..300 100 <- Minus
2L 19960854..19961030 1..177 100   Minus

IP21465.hyp Sequence

Translation from 0 to 675

> IP21465.hyp
AMGPRLYPAAILILHCLLLLFLQVDSRGNQNHTQMERQRHLRAHNLHRPP
YDGYDWHKHFNRDAEPKATVAKEKEEKTFKHRSGHLKKMKQTARDISNWS
RARSAYQKETAELEEWGRKKNITDNELKLFFDGEISTKDKYRLFGDIQTV
VQILKEVIKKGAVTEKEKAMITPELKPLILRFGRMFEREFAKNTNALEAL
QILVHEVQKSNSRNMRHKSAKRSH*

IP21465.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:21:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG34051-PA 223 CG34051-PA 1..223 2..224 1168 100 Plus
CG34051-PB 222 CG34051-PB 1..222 2..224 1152 99.6 Plus

IP21465.pep Sequence

Translation from 1 to 675

> IP21465.pep
AMGPRLYPAAILILHCLLLLFLQVDSRGNQNHTQMERQRHLRAHNLHRPP
YDGYDWHKHFNRDAEPKATVAKEKEEKTFKHRSGHLKKMKQTARDISNWS
RARSAYQKETAELEEWGRKKNITDNELKLFFDGEISTKDKYRLFGDIQTV
VQILKEVIKKGAVTEKEKAMITPELKPLILRFGRMFEREFAKNTNALEAL
QILVHEVQKSNSRNMRHKSAKRSH*

IP21465.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:17:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21603-PA 226 GG21603-PA 1..219 2..220 691 62.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:11:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG34051-PA 223 CG34051-PA 1..223 2..224 1168 100 Plus
CG34051-PB 222 CG34051-PB 1..222 2..224 1152 99.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:17:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16978-PA 224 GM16978-PA 1..221 2..222 968 86 Plus
Dsec\GM18814-PA 101 GM18814-PA 43..100 1..58 221 86.2 Plus
Dsec\GM11934-PA 101 GM11934-PA 43..100 1..58 221 86.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:17:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21727-PA 224 GD21727-PA 1..223 2..224 986 86.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:17:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12620-PA 222 GE12620-PA 1..221 2..224 736 61 Plus