Clone IP21476 Report

Search the DGRC for IP21476

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:214
Well:76
Vector:pOT2
Associated Gene/Transcriptlectin-37Db-RA
Protein status:IP21476.pep: gold
Sequenced Size:551

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
lectin-37Db 2008-05-05 Release 5.5 slip selected
lectin-37Db 2008-08-15 Release 5.9 accounting
lectin-37Db 2008-12-18 5.12 accounting

Clone Sequence Records

IP21476.complete Sequence

551 bp assembled on 2008-05-14

GenBank Submission: BT032983

> IP21476.complete
AGGAATGATGGTCAAACTTCTCCTGCTGTTCCTGGTATGCTGGAGTGCTC
TTCCTTTGGAGTCATCTCCCTTGGGTAACCGATATAACCTAGAGATCGGT
GAAAAGCAGTACTACATTTCGTTGGCAAAGACCAACTGGTTCGAGGCAAG
CAACCACTGTCGTCAGAATGGCGGATTTCTTCTCAATTTGGAGAGCAGAG
AGGAACTGGAGCTCCTTAGCCCCCACCTTCACCCAGCCTACAGCTATTGG
CTATCCATCAATGACCTCGGCGAACGGGGCGTATACGTGTCGGAGGCCAC
TGGTCTAGAGGCTCCGTTTCTTAACTGGTCCGCCGGAGAGCCGGACAACA
GCAGTGGCTACGATCGATGTGTCGAGCTGTGGTTGTCGACAACCTCCTTC
CAGATGAACGACCTCCCATGCTATAGCTCCGTCGCCTTCATTTGCCAGCT
TAACTAGGATCAAACTCTGGACTTCCATCAAAACAACTTGTTTTCTAAAT
GGTTAAAATTATAAAGCTGCAATTTTTCTTAAAAAAAAAAAAAAAAAAAA
A

IP21476.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:00:24
Subject Length Description Subject Range Query Range Score Percent Strand
lectin-37Db-RA 562 lectin-37Db-RA 19..549 1..531 2655 100 Plus
lectin-37Db-RB 562 lectin-37Db-RB 19..549 1..531 2655 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:26:58
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 19417843..19418289 84..530 2235 100 Plus
chr2L 23010047 chr2L 19417629..19417715 1..87 420 98.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:45:45 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:26:57
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19419307..19419754 84..531 2240 100 Plus
2L 23513712 2L 19419093..19419179 1..87 420 98.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:56:15
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19419307..19419754 84..531 2240 100 Plus
2L 23513712 2L 19419093..19419179 1..87 420 98.8 Plus
Blast to na_te.dros performed on 2019-03-16 00:26:57 has no hits.

IP21476.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:27:52 Download gff for IP21476.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 19417629..19417711 1..83 100 -> Plus
chr2L 19417843..19418289 84..530 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:25:44 Download gff for IP21476.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-37Db-RA 1..453 5..457 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:56:16 Download gff for IP21476.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-37Db-RB 1..453 5..457 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:35:53 Download gff for IP21476.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-37Db-RA 1..453 5..457 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:55:24 Download gff for IP21476.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-37Db-RA 1..453 5..457 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:01:19 Download gff for IP21476.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-37Db-RA 1..453 5..457 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:20:28 Download gff for IP21476.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-37Db-RA 1..453 5..457 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:56:16 Download gff for IP21476.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-37Db-RA 19..548 1..530 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:35:53 Download gff for IP21476.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-37Db-RA 19..548 1..530 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:55:24 Download gff for IP21476.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-37Db-RA 1..453 5..457 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:01:19 Download gff for IP21476.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-37Db-RA 19..548 1..530 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:27:52 Download gff for IP21476.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19419093..19419175 1..83 100 -> Plus
2L 19419307..19419753 84..530 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:27:52 Download gff for IP21476.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19419093..19419175 1..83 100 -> Plus
2L 19419307..19419753 84..530 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:27:52 Download gff for IP21476.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19419093..19419175 1..83 100 -> Plus
2L 19419307..19419753 84..530 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:35:53 Download gff for IP21476.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19419093..19419175 1..83 100 -> Plus
arm_2L 19419307..19419753 84..530 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:33:04 Download gff for IP21476.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19419093..19419175 1..83 100 -> Plus
2L 19419307..19419753 84..530 100   Plus

IP21476.hyp Sequence

Translation from 0 to 456

> IP21476.hyp
GMMVKLLLLFLVCWSALPLESSPLGNRYNLEIGEKQYYISLAKTNWFEAS
NHCRQNGGFLLNLESREELELLSPHLHPAYSYWLSINDLGERGVYVSEAT
GLEAPFLNWSAGEPDNSSGYDRCVELWLSTTSFQMNDLPCYSSVAFICQL
N*

IP21476.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:21:59
Subject Length Description Subject Range Query Range Score Percent Strand
lectin-37Db-PB 150 CG33533-PB 1..150 2..151 809 100 Plus
lectin-37Db-PA 150 CG33533-PA 1..150 2..151 809 100 Plus
lectin-24Db-PA 359 CG2958-PA 241..354 32..149 227 42 Plus
CG9134-PC 188 CG9134-PC 55..185 30..150 218 35.1 Plus
CG9134-PA 188 CG9134-PA 55..185 30..150 218 35.1 Plus

IP21476.pep Sequence

Translation from 1 to 456

> IP21476.pep
GMMVKLLLLFLVCWSALPLESSPLGNRYNLEIGEKQYYISLAKTNWFEAS
NHCRQNGGFLLNLESREELELLSPHLHPAYSYWLSINDLGERGVYVSEAT
GLEAPFLNWSAGEPDNSSGYDRCVELWLSTTSFQMNDLPCYSSVAFICQL
N*

IP21476.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:14:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15878-PA 212 GF15878-PA 92..209 30..149 220 41.5 Plus
Dana\GF15345-PA 204 GF15345-PA 82..198 30..149 218 40.5 Plus
Dana\GF24446-PA 386 GF24446-PA 253..383 30..150 205 35.1 Plus
Dana\GF14434-PA 168 GF14434-PA 42..159 31..149 204 35.8 Plus
Dana\GF15691-PA 176 GF15691-PA 55..171 31..149 197 38 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:14:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21177-PA 150 GG21177-PA 1..150 2..151 627 86.7 Plus
Dere\GG12225-PA 134 GG12225-PA 5..130 31..151 214 38.6 Plus
Dere\GG14773-PA 376 GG14773-PA 243..373 30..150 202 35.1 Plus
Dere\GG24987-PA 449 GG24987-PA 331..444 32..149 201 37 Plus
Dere\GG24559-PA 1288 GG24559-PA 141..255 31..149 201 37.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:14:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19636-PA 174 GH19636-PA 9..162 2..149 237 37.4 Plus
Dgri\GH13620-PA 176 GH13620-PA 42..165 30..149 230 37.6 Plus
Dgri\GH11271-PA 376 GH11271-PA 251..371 31..149 227 38 Plus
Dgri\GH23701-PA 385 GH23701-PA 260..380 31..149 226 38 Plus
Dgri\GH10464-PA 197 GH10464-PA 75..193 31..149 220 41.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:09:08
Subject Length Description Subject Range Query Range Score Percent Strand
lectin-37Db-PB 150 CG33533-PB 1..150 2..151 809 100 Plus
lectin-37Db-PA 150 CG33533-PA 1..150 2..151 809 100 Plus
lectin-24Db-PA 359 CG2958-PA 241..354 32..149 227 42 Plus
tfc-PC 188 CG9134-PC 55..185 30..150 218 35.1 Plus
tfc-PA 188 CG9134-PA 55..185 30..150 218 35.1 Plus
tfc-PB 376 CG9134-PB 243..373 30..150 218 35.1 Plus
lectin-22C-PB 263 CG42295-PB 141..255 31..149 204 36.7 Plus
CG2839-PA 826 CG2839-PA 151..265 31..151 203 36.9 Plus
CG7763-PD 232 CG7763-PD 111..227 31..149 196 33.3 Plus
CG7763-PC 232 CG7763-PC 111..227 31..149 196 33.3 Plus
CG15358-PE 252 CG15358-PE 131..245 32..149 192 39.5 Plus
CG15358-PD 252 CG15358-PD 131..245 32..149 192 39.5 Plus
lectin-21Ca-PA 269 CG2826-PA 147..266 31..150 183 33.6 Plus
lectin-33A-PB 177 CG16834-PB 11..157 6..149 179 31 Plus
lectin-37Da-PB 186 CG33532-PB 31..173 25..149 177 29.4 Plus
lectin-37Da-PA 186 CG33532-PA 31..173 25..149 177 29.4 Plus
lectin-24A-PA 282 CG3410-PA 164..279 31..149 168 30 Plus
lectin-21Cb-PB 249 CG13686-PB 134..247 31..149 167 33.3 Plus
Sfp24F-PA 175 CG42468-PA 28..165 19..149 165 34.8 Plus
Sfp24F-PB 175 CG42468-PB 28..165 19..149 165 34.8 Plus
lectin-28C-PC 265 CG7106-PC 146..262 32..151 163 29.4 Plus
lectin-28C-PB 265 CG7106-PB 146..262 32..151 163 29.4 Plus
CG15818-PA 283 CG15818-PA 161..278 31..149 150 31.4 Plus
Lectin-galC1-PB 186 CG9976-PB 45..173 31..149 148 27.1 Plus
Lectin-galC1-PA 186 CG9976-PA 45..173 31..149 148 27.1 Plus
Acp29AB-PA 234 CG17797-PA 116..229 31..149 144 31.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:14:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14022-PA 161 GI14022-PA 37..156 32..150 347 57.5 Plus
Dmoj\GI24801-PA 174 GI24801-PA 42..163 30..149 226 38.2 Plus
Dmoj\GI24628-PA 146 GI24628-PA 25..144 28..151 222 36.8 Plus
Dmoj\GI17697-PA 153 GI17697-PA 32..149 28..149 206 36.6 Plus
Dmoj\GI13046-PA 379 GI13046-PA 246..376 30..150 205 35.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:14:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10741-PA 236 GL10741-PA 112..231 30..149 251 43 Plus
Dper\GL26175-PA 238 GL26175-PA 101..222 31..149 225 38.5 Plus
Dper\GL26845-PA 183 GL26845-PA 47..176 20..149 211 37.9 Plus
Dper\GL26705-PA 277 GL26705-PA 156..276 31..149 203 32.8 Plus
Dper\GL16169-PA 214 GL16169-PA 61..167 30..127 179 37.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:14:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24466-PA 236 GA24466-PA 112..231 30..149 246 43 Plus
Dpse\GA25561-PA 181 GA25561-PA 44..165 31..149 225 38.5 Plus
Dpse\GA29021-PA 141 GA29021-PA 11..130 31..149 210 34.2 Plus
Dpse\GA29024-PA 277 GA29024-PA 156..276 31..149 203 32.8 Plus
Dpse\GA21567-PA 381 GA21567-PA 248..378 30..150 200 35.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:14:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17343-PA 150 GM17343-PA 1..150 2..151 690 96 Plus
Dsec\GM18457-PA 255 GM18457-PA 131..246 32..151 245 43 Plus
Dsec\GM14393-PA 375 GM14393-PA 242..372 30..150 203 35.1 Plus
Dsec\GM18119-PA 291 GM18119-PA 172..289 31..151 194 33.6 Plus
Dsec\GM16582-PA 268 GM16582-PA 147..261 32..149 193 38.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:14:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24202-PA 137 GD24202-PA 1..137 15..151 598 92 Plus
Dsim\GD12013-PA 358 GD12013-PA 240..355 32..151 247 43 Plus
Dsim\GD22877-PA 230 GD22877-PA 113..227 31..149 216 38.3 Plus
Dsim\GD23040-PA 783 GD23040-PA 151..265 31..151 209 40.2 Plus
Dsim\GD13601-PA 375 GD13601-PA 242..372 30..150 203 35.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:14:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18255-PA 159 GJ18255-PA 19..157 15..149 366 51.8 Plus
Dvir\GJ16447-PA 189 GJ16447-PA 68..185 31..149 268 44.2 Plus
Dvir\GJ16497-PA 252 GJ16497-PA 128..247 31..149 250 39.2 Plus
Dvir\GJ11333-PA 226 GJ11333-PA 99..224 31..149 244 40.9 Plus
Dvir\GJ16416-PA 164 GJ16416-PA 43..162 28..151 224 39.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:14:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24541-PA 431 GK24541-PA 113..211 31..128 219 45.5 Plus
Dwil\GK21163-PA 190 GK21163-PA 57..187 30..150 204 35.1 Plus
Dwil\GK19037-PA 249 GK19037-PA 105..239 15..149 203 33.8 Plus
Dwil\GK23835-PA 187 GK23835-PA 38..161 18..140 191 31.8 Plus
Dwil\GK23836-PA 283 GK23836-PA 133..270 17..149 179 30.1 Plus
Dwil\GK23836-PA 283 GK23836-PA 27..127 17..119 139 32.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:14:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13249-PA 150 GE13249-PA 1..150 2..151 624 89.3 Plus
Dyak\GE18275-PA 358 GE18275-PA 240..355 32..151 221 38 Plus
Dyak\GE10673-PA 153 GE10673-PA 29..152 31..149 203 36 Plus
Dyak\GE21136-PA 379 GE21136-PA 246..376 30..150 203 35.1 Plus
Dyak\GE16979-PA 269 GE16979-PA 147..266 31..150 188 35.2 Plus