IP21503.complete Sequence
312 bp assembled on 2008-12-10
GenBank Submission: BT053719.1
> IP21503.complete
CGATATTGAATCAAGTGAACGTGTTTACTTGAGCTTCCTCTAAAGTTATC
AAATCAGACTTCACAATGCTGATCAACCGACATTCCTGTTCGAAACTACT
TTCTTTGATGGTTTTGCTGTGCTTGGCATTTGACTTAAAACCAGTCTCGG
CGATGAAGTGTCGCCTTGGATTTGTAAAAAGGGGTGGACAATGCACTTGG
CCTTAAAAAGTGAAAAAAACTAATAGTCAAATTGTATCATTGTTGAATCA
ACTATATTGATTCCACCAAATAAATCATGTTTGAACATTACGCAAAAAAA
AAAAAAAAAAAA
IP21503.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:14:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Acp54A1-RA | 293 | Acp54A1-RA | 1..293 | 1..293 | 1465 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:04:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 13020641..13020933 | 1..293 | 1420 | 99 | Plus |
chr2R | 21145070 | chr2R | 8306474..8306590 | 129..14 | 205 | 80.3 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:45:47 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:04:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 17133458..17133753 | 1..296 | 1480 | 100 | Plus |
2R | 25286936 | 2R | 12419247..12419347 | 113..14 | 200 | 82.2 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:32:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 17134657..17134952 | 1..296 | 1480 | 100 | Plus |
Blast to na_te.dros performed 2019-03-16 05:04:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
blood | 7410 | blood BLOOD 7410bp | 6922..6998 | 290..211 | 104 | 62.5 | Minus |
IP21503.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:05:00 Download gff for
IP21503.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 13020641..13020933 | 1..293 | 98 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:04:04 Download gff for
IP21503.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp54A1-RA | 1..141 | 66..206 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:21:45 Download gff for
IP21503.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp54A1-RA | 1..141 | 66..206 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:15:05 Download gff for
IP21503.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp54A1-RA | 1..141 | 66..206 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:56:15 Download gff for
IP21503.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp54A1-RA | 1..141 | 66..206 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-12-10 17:49:46 Download gff for
IP21503.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp54A1-RA | 1..141 | 66..206 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:21:45 Download gff for
IP21503.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp54A1-RA | 1..293 | 1..293 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:15:05 Download gff for
IP21503.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp54A1-RA | 1..293 | 1..293 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:56:15 Download gff for
IP21503.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp54A1-RA | 14..306 | 1..293 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:05:00 Download gff for
IP21503.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 17133458..17133750 | 1..293 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:05:00 Download gff for
IP21503.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 17133458..17133750 | 1..293 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:05:00 Download gff for
IP21503.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 17133458..17133750 | 1..293 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:15:05 Download gff for
IP21503.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 13020963..13021255 | 1..293 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:53:24 Download gff for
IP21503.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 17134657..17134949 | 1..293 | 100 | | Plus |
IP21503.pep Sequence
Translation from 65 to 205
> IP21503.pep
MLINRHSCSKLLSLMVLLCLAFDLKPVSAMKCRLGFVKRGGQCTWP*
IP21503.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:19:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Acp54A1-PA | 46 | CG34098-PA | 1..46 | 1..46 | 247 | 100 | Plus |
IP21503.hyp Sequence
Translation from 65 to 205
> IP21503.hyp
MLINRHSCSKLLSLMVLLCLAFDLKPVSAMKCRLGFVKRGGQCTWP*
IP21503.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:22:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Acp54A1-PA | 46 | CG34098-PA | 1..46 | 1..46 | 247 | 100 | Plus |