Clone IP21503 Report

Search the DGRC for IP21503

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:215
Well:3
Vector:pOT2
Associated Gene/TranscriptAcp54A1-RA
Protein status:IP21503.pep: gold
Sequenced Size:312

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Acp54A1 2008-12-18 5.12 accounting

Clone Sequence Records

IP21503.complete Sequence

312 bp assembled on 2008-12-10

GenBank Submission: BT053719.1

> IP21503.complete
CGATATTGAATCAAGTGAACGTGTTTACTTGAGCTTCCTCTAAAGTTATC
AAATCAGACTTCACAATGCTGATCAACCGACATTCCTGTTCGAAACTACT
TTCTTTGATGGTTTTGCTGTGCTTGGCATTTGACTTAAAACCAGTCTCGG
CGATGAAGTGTCGCCTTGGATTTGTAAAAAGGGGTGGACAATGCACTTGG
CCTTAAAAAGTGAAAAAAACTAATAGTCAAATTGTATCATTGTTGAATCA
ACTATATTGATTCCACCAAATAAATCATGTTTGAACATTACGCAAAAAAA
AAAAAAAAAAAA

IP21503.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:14:50
Subject Length Description Subject Range Query Range Score Percent Strand
Acp54A1-RA 293 Acp54A1-RA 1..293 1..293 1465 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:04:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 13020641..13020933 1..293 1420 99 Plus
chr2R 21145070 chr2R 8306474..8306590 129..14 205 80.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:45:47 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:04:22
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17133458..17133753 1..296 1480 100 Plus
2R 25286936 2R 12419247..12419347 113..14 200 82.2 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:32:29
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 17134657..17134952 1..296 1480 100 Plus
Blast to na_te.dros performed 2019-03-16 05:04:22
Subject Length Description Subject Range Query Range Score Percent Strand
blood 7410 blood BLOOD 7410bp 6922..6998 290..211 104 62.5 Minus

IP21503.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:05:00 Download gff for IP21503.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 13020641..13020933 1..293 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:04:04 Download gff for IP21503.complete
Subject Subject Range Query Range Percent Splice Strand
Acp54A1-RA 1..141 66..206 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:21:45 Download gff for IP21503.complete
Subject Subject Range Query Range Percent Splice Strand
Acp54A1-RA 1..141 66..206 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:15:05 Download gff for IP21503.complete
Subject Subject Range Query Range Percent Splice Strand
Acp54A1-RA 1..141 66..206 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:56:15 Download gff for IP21503.complete
Subject Subject Range Query Range Percent Splice Strand
Acp54A1-RA 1..141 66..206 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-12-10 17:49:46 Download gff for IP21503.complete
Subject Subject Range Query Range Percent Splice Strand
Acp54A1-RA 1..141 66..206 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:21:45 Download gff for IP21503.complete
Subject Subject Range Query Range Percent Splice Strand
Acp54A1-RA 1..293 1..293 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:15:05 Download gff for IP21503.complete
Subject Subject Range Query Range Percent Splice Strand
Acp54A1-RA 1..293 1..293 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:56:15 Download gff for IP21503.complete
Subject Subject Range Query Range Percent Splice Strand
Acp54A1-RA 14..306 1..293 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:05:00 Download gff for IP21503.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17133458..17133750 1..293 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:05:00 Download gff for IP21503.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17133458..17133750 1..293 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:05:00 Download gff for IP21503.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17133458..17133750 1..293 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:15:05 Download gff for IP21503.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13020963..13021255 1..293 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:53:24 Download gff for IP21503.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17134657..17134949 1..293 100   Plus

IP21503.pep Sequence

Translation from 65 to 205

> IP21503.pep
MLINRHSCSKLLSLMVLLCLAFDLKPVSAMKCRLGFVKRGGQCTWP*

IP21503.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:19:46
Subject Length Description Subject Range Query Range Score Percent Strand
Acp54A1-PA 46 CG34098-PA 1..46 1..46 247 100 Plus

IP21503.hyp Sequence

Translation from 65 to 205

> IP21503.hyp
MLINRHSCSKLLSLMVLLCLAFDLKPVSAMKCRLGFVKRGGQCTWP*

IP21503.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:22:13
Subject Length Description Subject Range Query Range Score Percent Strand
Acp54A1-PA 46 CG34098-PA 1..46 1..46 247 100 Plus