Clone IP21509 Report

Search the DGRC for IP21509

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:215
Well:9
Vector:pOT2
Associated Gene/TranscriptCG15432-RA
Protein status:IP21509.pep: gold
Sequenced Size:579

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15432 2008-05-05 Release 5.5 slip selected
CG15432 2008-08-15 Release 5.9 accounting
CG15432 2008-12-18 5.12 accounting

Clone Sequence Records

IP21509.complete Sequence

579 bp assembled on 2008-05-14

GenBank Submission: BT032808

> IP21509.complete
AAACAAGAAAAACGTAAACAGATCGGATTCATTACCAATCCATTTCCAGA
TTGAAAACCCATTAAAGACATGTCCGACGAGTACGCCTGCGTGGCCAAGG
GCAAGCTTAAACTAAAGAACGATTCGGATCTCAAGAAGAAAAAGAAGAAG
CACAAGGGCAAGGACAAGGAGAAGGAGCTGCAGAAGGCGTTCGTGGAGCA
GCAAATAGCGGAATCGGGGGCCACATCCTCCTCCGCCACCAGTGGCTACG
AGCGGAAGCTCACCAAGGCCGAGCTGGCCAGTAAGAAGCAGCAGGAAAAG
ATGCGCAACAAGCGAATCATGGACAAGGCACAAACCACCCACAAGGAGCG
CGTGGAGAAATTCAACGAGCACCTGGACACGCTCACCGAGCACTTTGACA
TCCCCAAGGTGTCCTGGACGAAGTGAGGCGACGCCGCTCGTAACTTAAAG
CATACATTTATTATAAGGTTAAGTAATTTCGACTACGTTTCAACCTGGAG
CGCAGGAAAAGTGAGAGGGGAGGCCAAAATAAACAATCCAGATGGCACAA
CTAAGCTAAAAAAAAAAAAAAAAAAAAAA

IP21509.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:01:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG15432-RA 557 CG15432-RA 1..557 1..557 2785 100 Plus
CG15432.b 577 CG15432.b 67..577 47..557 2555 100 Plus
CG15432.a 617 CG15432.a 70..580 50..560 2555 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:59:24
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 4441566..4442122 1..557 2755 99.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:45:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:59:22
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4442429..4442988 1..560 2800 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:57:04
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4442429..4442988 1..560 2800 100 Plus
Blast to na_te.dros performed 2019-03-16 06:59:22
Subject Length Description Subject Range Query Range Score Percent Strand
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 638..699 139..200 121 66.1 Plus

IP21509.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:00:21 Download gff for IP21509.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 4441566..4442122 1..557 91   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:25:51 Download gff for IP21509.complete
Subject Subject Range Query Range Percent Splice Strand
CG15432-RA 1..357 70..426 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:58:14 Download gff for IP21509.complete
Subject Subject Range Query Range Percent Splice Strand
CG15432-RA 1..357 70..426 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:59:10 Download gff for IP21509.complete
Subject Subject Range Query Range Percent Splice Strand
CG15432-RA 1..357 70..426 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:57:09 Download gff for IP21509.complete
Subject Subject Range Query Range Percent Splice Strand
CG15432-RA 1..357 70..426 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:24:10 Download gff for IP21509.complete
Subject Subject Range Query Range Percent Splice Strand
CG15432-RA 1..357 70..426 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:22:12 Download gff for IP21509.complete
Subject Subject Range Query Range Percent Splice Strand
CG15432-RA 1..557 1..557 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:58:13 Download gff for IP21509.complete
Subject Subject Range Query Range Percent Splice Strand
CG15432-RA 1..557 1..557 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:59:10 Download gff for IP21509.complete
Subject Subject Range Query Range Percent Splice Strand
CG15432-RA 1..557 1..557 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:57:09 Download gff for IP21509.complete
Subject Subject Range Query Range Percent Splice Strand
CG15432-RA 1..357 70..426 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:24:10 Download gff for IP21509.complete
Subject Subject Range Query Range Percent Splice Strand
CG15432-RA 1..557 1..557 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:00:21 Download gff for IP21509.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4442429..4442985 1..557 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:00:21 Download gff for IP21509.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4442429..4442985 1..557 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:00:21 Download gff for IP21509.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4442429..4442985 1..557 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:59:10 Download gff for IP21509.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4442429..4442985 1..557 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:34:21 Download gff for IP21509.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4442429..4442985 1..557 100   Plus

IP21509.pep Sequence

Translation from 69 to 425

> IP21509.pep
MSDEYACVAKGKLKLKNDSDLKKKKKKHKGKDKEKELQKAFVEQQIAESG
ATSSSATSGYERKLTKAELASKKQQEKMRNKRIMDKAQTTHKERVEKFNE
HLDTLTEHFDIPKVSWTK*

IP21509.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:46:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21211-PA 115 GF21211-PA 1..115 1..118 399 83.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:46:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25003-PA 117 GG25003-PA 1..117 1..118 570 95.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:46:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10128-PA 121 GH10128-PA 1..121 1..118 415 81.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:26:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG15432-PC 118 CG15432-PC 1..118 1..118 602 100 Plus
CG15432-PB 118 CG15432-PB 1..118 1..118 602 100 Plus
CG15432-PA 118 CG15432-PA 1..118 1..118 602 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:46:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22139-PA 124 GI22139-PA 1..124 1..118 383 71 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:46:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15165-PA 121 GL15165-PA 1..121 1..118 439 88.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:46:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13722-PA 121 GA13722-PA 1..121 1..118 439 88.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:46:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18473-PA 118 GM18473-PA 1..118 1..118 599 98.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:46:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23287-PA 118 GD23287-PA 1..118 1..118 599 98.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:46:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20007-PA 122 GJ20007-PA 1..122 1..118 416 79.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:46:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24350-PA 116 GK24350-PA 1..116 1..118 386 74.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:46:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18290-PA 118 GE18290-PA 1..118 1..118 472 95.8 Plus

IP21509.hyp Sequence

Translation from 69 to 425

> IP21509.hyp
MSDEYACVAKGKLKLKNDSDLKKKKKKHKGKDKEKELQKAFVEQQIAESG
ATSSSATSGYERKLTKAELASKKQQEKMRNKRIMDKAQTTHKERVEKFNE
HLDTLTEHFDIPKVSWTK*

IP21509.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:22:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG15432-PC 118 CG15432-PC 1..118 1..118 602 100 Plus
CG15432-PB 118 CG15432-PB 1..118 1..118 602 100 Plus
CG15432-PA 118 CG15432-PA 1..118 1..118 602 100 Plus