BDGP Sequence Production Resources |
Search the DGRC for IP21509
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 215 |
Well: | 9 |
Vector: | pOT2 |
Associated Gene/Transcript | CG15432-RA |
Protein status: | IP21509.pep: gold |
Sequenced Size: | 579 |
Gene | Date | Evidence |
---|---|---|
CG15432 | 2008-05-05 | Release 5.5 slip selected |
CG15432 | 2008-08-15 | Release 5.9 accounting |
CG15432 | 2008-12-18 | 5.12 accounting |
579 bp assembled on 2008-05-14
GenBank Submission: BT032808
> IP21509.complete AAACAAGAAAAACGTAAACAGATCGGATTCATTACCAATCCATTTCCAGA TTGAAAACCCATTAAAGACATGTCCGACGAGTACGCCTGCGTGGCCAAGG GCAAGCTTAAACTAAAGAACGATTCGGATCTCAAGAAGAAAAAGAAGAAG CACAAGGGCAAGGACAAGGAGAAGGAGCTGCAGAAGGCGTTCGTGGAGCA GCAAATAGCGGAATCGGGGGCCACATCCTCCTCCGCCACCAGTGGCTACG AGCGGAAGCTCACCAAGGCCGAGCTGGCCAGTAAGAAGCAGCAGGAAAAG ATGCGCAACAAGCGAATCATGGACAAGGCACAAACCACCCACAAGGAGCG CGTGGAGAAATTCAACGAGCACCTGGACACGCTCACCGAGCACTTTGACA TCCCCAAGGTGTCCTGGACGAAGTGAGGCGACGCCGCTCGTAACTTAAAG CATACATTTATTATAAGGTTAAGTAATTTCGACTACGTTTCAACCTGGAG CGCAGGAAAAGTGAGAGGGGAGGCCAAAATAAACAATCCAGATGGCACAA CTAAGCTAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 4441566..4442122 | 1..557 | 2755 | 99.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 4442429..4442988 | 1..560 | 2800 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 4442429..4442988 | 1..560 | 2800 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
HMS-Beagle | 7062 | HMS-Beagle Beagle 7062bp | 638..699 | 139..200 | 121 | 66.1 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 4441566..4442122 | 1..557 | 91 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15432-RA | 1..357 | 70..426 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15432-RA | 1..357 | 70..426 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15432-RA | 1..357 | 70..426 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15432-RA | 1..357 | 70..426 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15432-RA | 1..357 | 70..426 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15432-RA | 1..557 | 1..557 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15432-RA | 1..557 | 1..557 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15432-RA | 1..557 | 1..557 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15432-RA | 1..357 | 70..426 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15432-RA | 1..557 | 1..557 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 4442429..4442985 | 1..557 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 4442429..4442985 | 1..557 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 4442429..4442985 | 1..557 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 4442429..4442985 | 1..557 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 4442429..4442985 | 1..557 | 100 | Plus |
Translation from 69 to 425
> IP21509.pep MSDEYACVAKGKLKLKNDSDLKKKKKKHKGKDKEKELQKAFVEQQIAESG ATSSSATSGYERKLTKAELASKKQQEKMRNKRIMDKAQTTHKERVEKFNE HLDTLTEHFDIPKVSWTK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF21211-PA | 115 | GF21211-PA | 1..115 | 1..118 | 399 | 83.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG25003-PA | 117 | GG25003-PA | 1..117 | 1..118 | 570 | 95.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH10128-PA | 121 | GH10128-PA | 1..121 | 1..118 | 415 | 81.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15432-PC | 118 | CG15432-PC | 1..118 | 1..118 | 602 | 100 | Plus |
CG15432-PB | 118 | CG15432-PB | 1..118 | 1..118 | 602 | 100 | Plus |
CG15432-PA | 118 | CG15432-PA | 1..118 | 1..118 | 602 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI22139-PA | 124 | GI22139-PA | 1..124 | 1..118 | 383 | 71 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL15165-PA | 121 | GL15165-PA | 1..121 | 1..118 | 439 | 88.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA13722-PA | 121 | GA13722-PA | 1..121 | 1..118 | 439 | 88.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM18473-PA | 118 | GM18473-PA | 1..118 | 1..118 | 599 | 98.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23287-PA | 118 | GD23287-PA | 1..118 | 1..118 | 599 | 98.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ20007-PA | 122 | GJ20007-PA | 1..122 | 1..118 | 416 | 79.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK24350-PA | 116 | GK24350-PA | 1..116 | 1..118 | 386 | 74.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE18290-PA | 118 | GE18290-PA | 1..118 | 1..118 | 472 | 95.8 | Plus |
Translation from 69 to 425
> IP21509.hyp MSDEYACVAKGKLKLKNDSDLKKKKKKHKGKDKEKELQKAFVEQQIAESG ATSSSATSGYERKLTKAELASKKQQEKMRNKRIMDKAQTTHKERVEKFNE HLDTLTEHFDIPKVSWTK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15432-PC | 118 | CG15432-PC | 1..118 | 1..118 | 602 | 100 | Plus |
CG15432-PB | 118 | CG15432-PB | 1..118 | 1..118 | 602 | 100 | Plus |
CG15432-PA | 118 | CG15432-PA | 1..118 | 1..118 | 602 | 100 | Plus |