Clone IP21535 Report

Search the DGRC for IP21535

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:215
Well:35
Vector:pOT2
Associated Gene/TranscriptProsalpha3T-RA
Protein status:IP21535.pep: gold
Sequenced Size:909

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Prosalpha3T 2008-05-05 Release 5.5 slip selected
Prosalpha3T 2008-08-15 Release 5.9 accounting
Prosalpha3T 2008-12-18 5.12 accounting

Clone Sequence Records

IP21535.complete Sequence

909 bp assembled on 2008-05-22

GenBank Submission: BT032812

> IP21535.complete
TAATCTGCTATATATTTTTTTATTTTACCAAACGATGGCCCGTTTCTTCG
ATTCCCGCACCACGATCTTTTCACCGGAGGGCCGCCTCTATCAGGTGGAG
TATGCGATGGAGGCCGCTTCGCAGTCGGGCACATGCGTGGGACTCCTGGC
TAAGAACGGAGTCCTGTTGGCCACTGAACGAAGCGTTGACAAGCTCATGG
ACACCAGTATTCCTGTGCCAAGAATCTCGTGGTTGAACGAGAACATTGCC
TGTTGCGCCACGGGCAACACGGCGGATGGTAACGTGCTGGTTAACCAACT
GCGAATGATCGCCCAACAATATCAGTTCAACTTCGGTGAGATGATTCCTT
GCGAGCAGTTGGTCACGAACCTTTGCGATATCAAACAGGCGTATACGCAA
TATGGTGGCAAACGACCCTTCGGGGTATCGTTTCTTTACATGGGCTGGGA
TTGCCGCTTCGGGTTTCAGTTGTATCAGTCCGATCCCAGTGGAAACTACA
GTGGCTGGAAGGCCACCTGCATTGGCCGCAAGTCAGGGGCAGCCATGGAA
ATGCTTCAGAAGGAACTATTTAGCAAGGGCTACGTAAGTCCTTCGGTCGA
GGAGGCCAAGGATGTAGCCATCAAGGTCATGGGCATGACCTTGGGCAGAG
ATAGCTTGACCCCCGAAAAACTGGAAATTGCTTTCGTACAGCGTTACGGT
AACACCACCGTCTTTCATATTTTAGAAAAAAACGAGATCCACCGGCTAAT
CGAAAGGAATAACAATTTGAAGAGGCGCGTCGGGTCGTAAAGAGAAAATT
TTTTAGTCATTAGTTACTTTTATAATGTTTATATATGTTATATGTTACAT
TTTAAAAACTAAAAATTGTTTCCTAAAACTATGATCCAGAAAAAAAAAAA
AAAAAAAAA

IP21535.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:52:16
Subject Length Description Subject Range Query Range Score Percent Strand
Prosalpha3T-RA 1385 Prosalpha3T-RA 103..994 1..892 4460 100 Plus
Pros29.a 955 Pros29.a 338..491 297..450 290 79.2 Plus
Pros29-RA 1101 Pros29-RA 467..620 297..450 290 79.2 Plus
Pros29.a 955 Pros29.a 88..209 50..171 235 79.5 Plus
Pros29-RA 1101 Pros29-RA 217..338 50..171 235 79.5 Plus
Pros29.a 955 Pros29.a 512..567 471..526 160 85.7 Plus
Pros29-RA 1101 Pros29-RA 641..696 471..526 160 85.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:19:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 26944920..26945808 889..1 4370 99.4 Minus
chr2R 21145070 chr2R 16881934..16882163 297..526 355 77 Plus
chr2R 21145070 chr2R 16881547..16881668 50..171 250 80.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:45:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:19:12
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 31122524..31123415 892..1 4460 100 Minus
2R 25286936 2R 20995502..20995731 297..526 370 77.4 Plus
2R 25286936 2R 20995115..20995236 50..171 235 79.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:48:52
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 30863355..30864246 892..1 4460 100 Minus
2R 25260384 2R 20996701..20996854 297..450 290 79.2 Plus
2R 25260384 2R 20996314..20996435 50..171 235 79.5 Plus
2R 25260384 2R 20996875..20996930 471..526 160 85.7 Plus
Blast to na_te.dros performed 2019-03-15 20:19:12
Subject Length Description Subject Range Query Range Score Percent Strand
roo 9092 roo DM_ROO 9092bp 1186..1305 879..760 121 59.8 Minus
Damb\P-element_T 3329 Damb\P-element_T P_T 3329bp Derived from AF012414. 2359..2404 843..799 110 73.9 Minus

IP21535.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:20:01 Download gff for IP21535.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 26944920..26945808 1..889 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:26:07 Download gff for IP21535.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha3T-RA 1..756 35..790 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:39:01 Download gff for IP21535.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha3T-RA 1..756 35..790 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 04:51:38 Download gff for IP21535.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha3T-RA 1..756 35..790 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:44:51 Download gff for IP21535.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha3T-RA 1..756 35..790 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:34:03 Download gff for IP21535.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha3T-RA 1..756 35..790 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:08:18 Download gff for IP21535.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha3T-RA 103..991 1..889 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:39:01 Download gff for IP21535.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha3T-RA 103..991 1..889 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:51:38 Download gff for IP21535.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha3T-RA 103..991 1..889 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:44:51 Download gff for IP21535.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha3T-RA 103..991 1..889 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:34:03 Download gff for IP21535.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha3T-RA 1..889 1..889 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:20:01 Download gff for IP21535.complete
Subject Subject Range Query Range Percent Splice Strand
3R 31122527..31123415 1..889 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:20:01 Download gff for IP21535.complete
Subject Subject Range Query Range Percent Splice Strand
3R 31122527..31123415 1..889 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:20:01 Download gff for IP21535.complete
Subject Subject Range Query Range Percent Splice Strand
3R 31122527..31123415 1..889 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:51:38 Download gff for IP21535.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 26948249..26949137 1..889 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:21:24 Download gff for IP21535.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30863358..30864246 1..889 100   Minus

IP21535.hyp Sequence

Translation from 0 to 789

> IP21535.hyp
NLLYIFLFYQTMARFFDSRTTIFSPEGRLYQVEYAMEAASQSGTCVGLLA
KNGVLLATERSVDKLMDTSIPVPRISWLNENIACCATGNTADGNVLVNQL
RMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPFGVSFLYMGWD
CRFGFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQKELFSKGYVSPSVE
EAKDVAIKVMGMTLGRDSLTPEKLEIAFVQRYGNTTVFHILEKNEIHRLI
ERNNNLKRRVGS*

IP21535.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:22:54
Subject Length Description Subject Range Query Range Score Percent Strand
Prosalpha3T-PA 251 CG1736-PA 1..251 12..262 1315 100 Plus
Prosalpha3-PA 264 CG9327-PA 1..242 12..252 829 64 Plus
Prosalpha2-PA 234 CG5266-PA 11..176 21..187 326 43.1 Plus
Prosalpha4T1-PA 249 CG17268-PA 1..243 12..259 320 31 Plus
Prosalpha1-PB 244 CG18495-PB 9..233 16..246 316 34.9 Plus

IP21535.pep Sequence

Translation from 1 to 789

> IP21535.pep
NLLYIFLFYQTMARFFDSRTTIFSPEGRLYQVEYAMEAASQSGTCVGLLA
KNGVLLATERSVDKLMDTSIPVPRISWLNENIACCATGNTADGNVLVNQL
RMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPFGVSFLYMGWD
CRFGFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQKELFSKGYVSPSVE
EAKDVAIKVMGMTLGRDSLTPEKLEIAFVQRYGNTTVFHILEKNEIHRLI
ERNNNLKRRVGS*

IP21535.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:34:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12213-PA 265 GF12213-PA 1..242 12..252 873 64.9 Plus
Dana\GF17957-PA 234 GF17957-PA 11..176 21..187 348 43.7 Plus
Dana\GF11235-PA 244 GF11235-PA 9..239 16..252 332 34 Plus
Dana\GF19028-PA 249 GF19028-PA 1..183 12..199 301 35.4 Plus
Dana\GF11246-PA 252 GF11246-PA 1..177 12..188 295 33.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:34:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11887-PA 254 GG11887-PA 1..250 12..261 1141 82.4 Plus
Dere\GG22074-PA 264 GG22074-PA 1..246 12..256 872 63.4 Plus
Dere\GG18927-PA 234 GG18927-PA 11..176 21..187 339 43.1 Plus
Dere\GG10705-PA 244 GG10705-PA 9..239 16..252 329 33.6 Plus
Dere\GG15180-PA 251 GG15180-PA 1..215 12..231 326 33.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:34:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20521-PA 263 GH20521-PA 1..244 12..256 864 63 Plus
Dgri\GH13898-PA 234 GH13898-PA 11..176 21..187 351 43.7 Plus
Dgri\GH20588-PA 244 GH20588-PA 9..239 16..252 312 32.8 Plus
Dgri\GH12557-PA 249 GH12557-PA 1..225 12..253 300 32.5 Plus
Dgri\GH20892-PA 254 GH20892-PA 5..206 16..218 285 33 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:16:46
Subject Length Description Subject Range Query Range Score Percent Strand
Prosalpha3T-PA 251 CG1736-PA 1..251 12..262 1315 100 Plus
Prosalpha3-PA 264 CG9327-PA 1..242 12..252 829 64 Plus
Prosalpha2-PA 234 CG5266-PA 11..176 21..187 326 43.1 Plus
Prosalpha4T1-PA 249 CG17268-PA 1..243 12..259 320 31 Plus
Prosalpha1-PB 244 CG18495-PB 9..233 16..246 316 34.9 Plus
Prosalpha1-PA 244 CG18495-PA 9..233 16..246 316 34.9 Plus
CG30382-PB 244 CG30382-PB 9..233 16..246 316 34.9 Plus
CG30382-PA 244 CG30382-PA 9..233 16..246 316 34.9 Plus
Prosalpha4T2-PB 252 CG4569-PB 1..176 12..187 300 37.3 Plus
Prosalpha4T2-PA 252 CG4569-PA 1..176 12..187 300 37.3 Plus
Prosalpha4-PA 249 CG3422-PA 1..176 12..187 288 33.5 Plus
Prosalpha7-PA 253 CG1519-PA 3..231 11..246 275 30.5 Plus
Prosalpha6-PA 279 CG4904-PA 6..176 16..189 257 37.7 Plus
Prosalpha6-PB 279 CG4904-PB 6..176 16..189 257 37.7 Plus
Prosalpha6T-PA 289 CG5648-PA 6..236 16..251 257 30.1 Plus
Prosalpha5-PB 244 CG10938-PB 8..241 16..251 239 28.8 Plus
Prosalpha5-PA 244 CG10938-PA 8..241 16..251 239 28.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:34:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21067-PA 263 GI21067-PA 1..244 12..256 870 64.6 Plus
Dmoj\GI24829-PA 234 GI24829-PA 11..176 21..187 351 43.7 Plus
Dmoj\GI18257-PA 254 GI18257-PA 4..197 12..205 313 37.1 Plus
Dmoj\GI19734-PA 244 GI19734-PA 9..234 16..247 308 33 Plus
Dmoj\GI18902-PA 253 GI18902-PA 4..164 16..176 305 37.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:34:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10139-PA 262 GL10139-PA 1..245 12..257 878 64.3 Plus
Dper\GL22394-PA 246 GL22394-PA 1..238 12..252 646 50.4 Plus
Dper\GL27312-PA 234 GL27312-PA 11..176 21..187 347 43.7 Plus
Dper\GL17442-PA 244 GL17442-PA 9..239 16..252 320 33.2 Plus
Dper\GL20413-PA 252 GL20413-PA 1..215 12..230 304 34.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:34:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21704-PA 262 GA21704-PA 1..245 12..257 878 64.3 Plus
Dpse\GA28930-PA 246 GA28930-PA 1..238 12..252 642 50 Plus
Dpse\GA18772-PA 234 GA18772-PA 11..176 21..187 347 43.7 Plus
Dpse\GA15805-PA 244 GA15805-PA 9..239 16..252 320 33.2 Plus
Dpse\GA25292-PA 249 GA25292-PA 1..225 12..253 317 33.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:34:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12106-PA 257 GM12106-PA 1..249 12..260 1158 86.3 Plus
Dsec\GM15792-PA 264 GM15792-PA 1..242 12..252 867 63.6 Plus
Dsec\GM24033-PA 234 GM24033-PA 11..176 21..187 339 43.1 Plus
Dsec\GM20751-PA 244 GM20751-PA 9..239 16..252 339 33.8 Plus
Dsec\Pros28.1B-PA 252 GM11825-PA 1..248 12..259 324 32.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:34:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16600-PA 257 GD16600-PA 1..249 12..260 1152 86.3 Plus
Dsim\GD11553-PA 264 GD11553-PA 1..242 12..252 867 63.6 Plus
Dsim\GD18834-PA 234 GD18834-PA 11..176 21..187 339 43.1 Plus
Dsim\GD10216-PA 244 GD10216-PA 9..239 16..252 339 33.8 Plus
Dsim\Pros28.1B-PA 252 GD24946-PA 1..248 12..259 321 31.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:34:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21990-PA 263 GJ21990-PA 1..244 12..256 836 63.4 Plus
Dvir\GJ24473-PA 234 GJ24473-PA 11..176 21..187 350 43.7 Plus
Dvir\GJ20726-PA 251 GJ20726-PA 5..177 16..189 305 37.9 Plus
Dvir\Pros28.1-PA 249 GJ18504-PA 1..177 12..188 300 36 Plus
Dvir\GJ18434-PA 244 GJ18434-PA 9..234 16..247 298 32.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:34:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22956-PA 262 GK22956-PA 1..244 12..256 878 65.4 Plus
Dwil\GK14404-PA 234 GK14404-PA 11..217 21..233 354 38.3 Plus
Dwil\GK21354-PA 244 GK21354-PA 9..234 16..247 317 33 Plus
Dwil\GK25669-PA 249 GK25669-PA 1..225 12..253 293 31 Plus
Dwil\GK20963-PA 256 GK20963-PA 3..201 11..209 280 32.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:34:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23336-PA 253 GE23336-PA 1..249 12..260 1117 81.1 Plus
Dyak\GE12155-PA 264 GE12155-PA 1..246 12..256 872 63.4 Plus
Dyak\GE26194-PA 234 GE26194-PA 11..176 21..187 341 43.1 Plus
Dyak\GE23574-PA 244 GE23574-PA 9..239 16..252 327 33.6 Plus
Dyak\GE11446-PA 252 GE11446-PA 1..215 12..230 326 36.2 Plus