Clone IP21563 Report

Search the DGRC for IP21563

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:215
Well:63
Vector:pOT2
Protein status:IP21563.pep: Imported from assembly
Sequenced Size:1006

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15754 2008-05-05 Release 5.5 slip selected
CG15754 2008-08-15 Release 5.9 accounting
CG15754 2008-12-18 5.12 accounting

Clone Sequence Records

IP21563.complete Sequence

1006 bp assembled on 2008-05-14

GenBank Submission: BT032814

> IP21563.complete
ATCCAATCAGTATCATCTGCTGCAGCTGCACCTGCTGCTCTGCGCCTTGC
TCCTGACCTCTGGCCAAAGGACACCGGTTCGCGTTCCGCCGCGAAATCTG
CAGGTGCCCAACATTGGGGGCGAGAGCTTCGAGAGATTCGACACCCGATC
GGCATCGACGTCGAGCAGCGGAAGCAGCGAGAGCCAGGAGACCAGCGATG
AGATGCGGGAGCAACTGAAGCAACTTCTGGGCGACCAGCTGGCCACCGCC
TTTGCCCCCTTGGCCACCACGCCATTCACCAGGCGACAGCCGGCCATTGC
ATCACCCAGCTCGGGGGCGGCTGCCCGTTCCCAGTTCGCCACCGATCCGG
ATCAGGGCCAGGAAGAAGAGTCCCCGGACCAGGACGGCGAGGCGGAAGAG
GCAGAAGAGGAGGAGGAAGACGAAGAGGAGCAGGAGGAGGCCACTCCGCA
ACCTCAGCCACTGCCACCAGCTCTACCGCAACCAGGAGGCGTCTTGGAGG
AGCTGGCTGGTGGTCAGGTGGACGAGGAGCTGGAGGATTATAATGCCTGG
CGCGACAATTTCTATGAACTCAACGAAGACGGAAGCTATATCTTTGGCTA
CTCCATTCCCCATGGCATTCGTCGCTGGGAGAAGGGCTACTATTCGGAGG
AGCAGCATGGCCGGGTGGTTGAGGGCTTCTATGTCCAGCCCCGTCACGAT
TCCCAGGGCCTGAGATATGAGCTTCGATGCTACAGAGCCGATTCCGAGGG
CTATCAGCCGCGTCCAGTTGAGTTTCTGAGGACGCCGCCAATTGTGAGGC
GCGATGCCATACCGCGTGTTAATTGCTTCCAAAATGCTTAAAAATAATAG
ACGAAAATAATCCGTAAATAATCAGAAACCAAACGTTGAATGTGTGACTT
TAAAATCAAATAACACAAATCTTAACTAAAGAAAGTGGTAACTGCCCTAA
TTTTTTTGTGCACGAATGTAAATATATGTATGGAAAATGAAAAAAAAAAA
AAAAAA

IP21563.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:01:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG15754-RA 1024 CG15754-RA 13..1001 1..989 4945 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:29:10
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 13418799..13419395 1..597 2985 100 Plus
chrX 22417052 chrX 13419837..13420061 765..989 1125 100 Plus
chrX 22417052 chrX 13419599..13419769 597..767 855 100 Plus
chrX 22417052 chrX 15541979..15542033 245..191 230 94.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:46:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:29:07
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 13528018..13528614 1..597 2985 100 Plus
X 23542271 X 13529056..13529280 765..989 1125 100 Plus
X 23542271 X 13528818..13528988 597..767 855 100 Plus
X 23542271 X 15652087..15652141 245..191 230 94.5 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:56:59
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 13536116..13536712 1..597 2985 100 Plus
X 23527363 X 13537154..13537378 765..989 1125 100 Plus
X 23527363 X 13536916..13537086 597..767 855 100 Plus
X 23527363 X 15660185..15660239 245..191 230 94.5 Minus
Blast to na_te.dros performed 2019-03-16 13:29:08
Subject Length Description Subject Range Query Range Score Percent Strand
297 6995 297 DMIS297 6995bp Derived from X03431 (g8146) (Rel. 36, Last updated, Version 2). 710..811 821..918 112 60.8 Plus

IP21563.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:29:54 Download gff for IP21563.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 13419239..13419395 441..597 100 -> Plus
chrX 13419600..13419769 598..767 100 -> Plus
chrX 13419840..13420061 768..989 100   Plus
chrX 13418799..13419186 1..388 100 == Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:26:16 Download gff for IP21563.complete
Subject Subject Range Query Range Percent Splice Strand
CG15754-RA 6..846 1..841 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:58:04 Download gff for IP21563.complete
Subject Subject Range Query Range Percent Splice Strand
CG15754-RA 6..846 1..841 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:28:50 Download gff for IP21563.complete
Subject Subject Range Query Range Percent Splice Strand
CG15754-RA 6..846 1..841 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:56:54 Download gff for IP21563.complete
Subject Subject Range Query Range Percent Splice Strand
CG15754-RA 6..846 1..841 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:20:02 Download gff for IP21563.complete
Subject Subject Range Query Range Percent Splice Strand
CG15754-RA 6..846 1..841 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:22:01 Download gff for IP21563.complete
Subject Subject Range Query Range Percent Splice Strand
CG15754-RA 6..846 1..841 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:58:04 Download gff for IP21563.complete
Subject Subject Range Query Range Percent Splice Strand
CG15754-RA 6..994 1..989 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:28:50 Download gff for IP21563.complete
Subject Subject Range Query Range Percent Splice Strand
CG15754-RA 13..1001 1..989 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:56:54 Download gff for IP21563.complete
Subject Subject Range Query Range Percent Splice Strand
CG15754-RA 6..846 1..841 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:20:02 Download gff for IP21563.complete
Subject Subject Range Query Range Percent Splice Strand
CG15754-RA 13..1001 1..989 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:29:54 Download gff for IP21563.complete
Subject Subject Range Query Range Percent Splice Strand
X 13528018..13528614 1..597 100 -> Plus
X 13528819..13528988 598..767 100 -> Plus
X 13529059..13529280 768..989 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:29:54 Download gff for IP21563.complete
Subject Subject Range Query Range Percent Splice Strand
X 13528018..13528614 1..597 100 -> Plus
X 13528819..13528988 598..767 100 -> Plus
X 13529059..13529280 768..989 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:29:54 Download gff for IP21563.complete
Subject Subject Range Query Range Percent Splice Strand
X 13528018..13528614 1..597 100 -> Plus
X 13528819..13528988 598..767 100 -> Plus
X 13529059..13529280 768..989 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:28:50 Download gff for IP21563.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 13422051..13422647 1..597 100 -> Plus
arm_X 13422852..13423021 598..767 100 -> Plus
arm_X 13423092..13423313 768..989 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:34:14 Download gff for IP21563.complete
Subject Subject Range Query Range Percent Splice Strand
X 13536116..13536712 1..597 100 -> Plus
X 13536917..13537086 598..767 100 -> Plus
X 13537157..13537378 768..989 100   Plus

IP21563.hyp Sequence

Translation from 0 to 840

> IP21563.hyp
SNQYHLLQLHLLLCALLLTSGQRTPVRVPPRNLQVPNIGGESFERFDTRS
ASTSSSGSSESQETSDEMREQLKQLLGDQLATAFAPLATTPFTRRQPAIA
SPSSGAAARSQFATDPDQGQEEESPDQDGEAEEAEEEEEDEEEQEEATPQ
PQPLPPALPQPGGVLEELAGGQVDEELEDYNAWRDNFYELNEDGSYIFGY
SIPHGIRRWEKGYYSEEQHGRVVEGFYVQPRHDSQGLRYELRCYRADSEG
YQPRPVEFLRTPPIVRRDAIPRVNCFQNA*

IP21563.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:23:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG15754-PA 281 CG15754-PA 3..281 1..279 1472 100 Plus

IP21563.pep Sequence

Translation from 1 to 840

> IP21563.pep
SNQYHLLQLHLLLCALLLTSGQRTPVRVPPRNLQVPNIGGESFERFDTRS
ASTSSSGSSESQETSDEMREQLKQLLGDQLATAFAPLATTPFTRRQPAIA
SPSSGAAARSQFATDPDQGQEEESPDQDGEAEEAEEEEEDEEEQEEATPQ
PQPLPPALPQPGGVLEELAGGQVDEELEDYNAWRDNFYELNEDGSYIFGY
SIPHGIRRWEKGYYSEEQHGRVVEGFYVQPRHDSQGLRYELRCYRADSEG
YQPRPVEFLRTPPIVRRDAIPRVNCFQNA*

IP21563.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:33:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22570-PA 276 GF22570-PA 20..270 17..278 569 50 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:33:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17786-PA 304 GG17786-PA 21..302 19..279 936 82.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:33:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12495-PA 273 GH12495-PA 89..270 82..277 369 41.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:28:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG15754-PA 281 CG15754-PA 3..281 1..279 1472 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:33:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14847-PA 131 GI14847-PA 30..127 180..276 346 63.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:33:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20234-PA 274 GL20234-PA 29..272 22..278 623 54 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:33:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13935-PA 274 GA13935-PA 29..272 22..278 616 53.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:33:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17611-PA 282 GM17611-PA 3..280 1..279 1391 96.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:33:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17130-PA 282 GD17130-PA 3..280 1..279 1405 97.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:33:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19293-PA 270 GJ19293-PA 10..267 7..277 446 39.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:33:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20082-PA 244 GK20082-PA 28..240 27..278 524 48.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:33:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17081-PA 288 GE17081-PA 3..286 1..279 986 81.1 Plus