Clone IP21622 Report

Search the DGRC for IP21622

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:216
Well:22
Vector:pOT2
Associated Gene/TranscriptCG34012-RA
Protein status:IP21622.pep: gold
Sequenced Size:570

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34012 2008-05-05 Release 5.5 slip selected
CG34012 2008-08-15 Release 5.9 accounting
CG34012 2008-12-18 5.12 accounting

Clone Sequence Records

IP21622.complete Sequence

570 bp assembled on 2008-05-14

GenBank Submission: BT032818

> IP21622.complete
CTATATCCAAATTCCTGTGAAATCTGAAAAATGTCGCATGGGAATAAGCA
AAATTTCACCAAGATCTGGGATCTTGGAAAGTGGGAATCGCGGGATATAA
AGCATTACAGCACAATATCGCGAATCCAAAAACAACTACGTCTCGGAAAC
TGGGAATATCTCTGTCAGCATCCAGAGATACGGGCCATAATTCGTGTTAT
CCTTCATCAGGCACTCAATGGAAAACCGAAGCCGGAAAATCTCCGAAAAT
TTGTTGCTGATTTGTTCAACTGCGCACAGAATCCGCTGCTAGTGCCTATG
ATTAACACACAGCTGAAGTACGTTAAGAACGAATTGAAACGTGGCCGCTG
GAGTCAGTTCGACGCCGAGATGCTCTTCATGGAGAGTCCATCGACGCACT
CACTCCTCTCGACGGCATCCGAGGATAGCAATGTCCATCCGGTGCTTACA
TATGCGCTGGTCTTCAAGAAACCCGATGAGTGCGGCATCGACAAGCCGCC
GTTCTAGCACCAAAACTAAATTTATGTATTAAAGTCCAAAGTACTACAAT
TAAAAAAAAAAAAAAAAAAA

IP21622.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:57:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG34012-RA 670 CG34012-RA 50..602 1..553 2765 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:40:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 11099702..11099946 544..300 1195 99.2 Minus
chr3L 24539361 chr3L 11100204..11100380 177..1 885 100 Minus
chr3L 24539361 chr3L 11100019..11100143 300..176 625 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:46:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:40:16
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11108818..11109071 553..300 1270 100 Minus
3L 28110227 3L 11109329..11109505 177..1 885 100 Minus
3L 28110227 3L 11109144..11109268 300..176 625 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:53:26
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 11101918..11102171 553..300 1270 100 Minus
3L 28103327 3L 11102429..11102605 177..1 885 100 Minus
3L 28103327 3L 11102244..11102368 300..176 625 100 Minus
Blast to na_te.dros performed on 2019-03-16 11:40:16 has no hits.

IP21622.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:41:06 Download gff for IP21622.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 11100204..11100380 1..177 100   Minus
chr3L 11099694..11099945 301..551 98 <- Minus
chr3L 11100019..11100141 178..300 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:26:40 Download gff for IP21622.complete
Subject Subject Range Query Range Percent Splice Strand
CG34012-RA 1..477 31..507 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:49:31 Download gff for IP21622.complete
Subject Subject Range Query Range Percent Splice Strand
CG34012-RA 1..477 31..507 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:18:34 Download gff for IP21622.complete
Subject Subject Range Query Range Percent Splice Strand
CG34012-RA 1..477 31..507 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:48:48 Download gff for IP21622.complete
Subject Subject Range Query Range Percent Splice Strand
CG34012-RA 1..477 31..507 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:24:26 Download gff for IP21622.complete
Subject Subject Range Query Range Percent Splice Strand
CG34012-RA 1..477 31..507 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:12:18 Download gff for IP21622.complete
Subject Subject Range Query Range Percent Splice Strand
CG34012-RA 1..477 31..507 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:49:31 Download gff for IP21622.complete
Subject Subject Range Query Range Percent Splice Strand
CG34012-RA 1..551 1..551 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:18:34 Download gff for IP21622.complete
Subject Subject Range Query Range Percent Splice Strand
CG34012-RA 1..551 1..551 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:48:48 Download gff for IP21622.complete
Subject Subject Range Query Range Percent Splice Strand
CG34012-RA 1..477 31..507 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:24:26 Download gff for IP21622.complete
Subject Subject Range Query Range Percent Splice Strand
CG34012-RA 1..551 1..551 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:41:06 Download gff for IP21622.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11108820..11109070 301..551 100 <- Minus
3L 11109144..11109266 178..300 100 <- Minus
3L 11109329..11109505 1..177 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:41:06 Download gff for IP21622.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11108820..11109070 301..551 100 <- Minus
3L 11109144..11109266 178..300 100 <- Minus
3L 11109329..11109505 1..177 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:41:06 Download gff for IP21622.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11108820..11109070 301..551 100 <- Minus
3L 11109144..11109266 178..300 100 <- Minus
3L 11109329..11109505 1..177 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:18:34 Download gff for IP21622.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11101920..11102170 301..551 100 <- Minus
arm_3L 11102244..11102366 178..300 100 <- Minus
arm_3L 11102429..11102605 1..177 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:28:28 Download gff for IP21622.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11101920..11102170 301..551 100 <- Minus
3L 11102244..11102366 178..300 100 <- Minus
3L 11102429..11102605 1..177 100   Minus

IP21622.hyp Sequence

Translation from 30 to 506

> IP21622.hyp
MSHGNKQNFTKIWDLGKWESRDIKHYSTISRIQKQLRLGNWEYLCQHPEI
RAIIRVILHQALNGKPKPENLRKFVADLFNCAQNPLLVPMINTQLKYVKN
ELKRGRWSQFDAEMLFMESPSTHSLLSTASEDSNVHPVLTYALVFKKPDE
CGIDKPPF*

IP21622.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:24:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG34012-PA 158 CG34012-PA 1..158 1..158 850 100 Plus
CG34021-PA 161 CG34021-PA 30..128 24..124 199 42.6 Plus

IP21622.pep Sequence

Translation from 30 to 506

> IP21622.pep
MSHGNKQNFTKIWDLGKWESRDIKHYSTISRIQKQLRLGNWEYLCQHPEI
RAIIRVILHQALNGKPKPENLRKFVADLFNCAQNPLLVPMINTQLKYVKN
ELKRGRWSQFDAEMLFMESPSTHSLLSTASEDSNVHPVLTYALVFKKPDE
CGIDKPPF*

IP21622.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:06:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24571-PA 158 GF24571-PA 1..158 1..158 677 76.6 Plus
Dana\GF19817-PA 157 GF19817-PA 20..124 16..122 215 43 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:06:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13937-PA 158 GG13937-PA 1..158 1..158 805 92.4 Plus
Dere\GG20276-PA 158 GG20276-PA 31..141 24..135 204 40.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:06:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23291-PA 156 GH23291-PA 2..156 3..158 628 73.2 Plus
Dgri\GH14642-PA 156 GH14642-PA 2..156 3..158 624 72.6 Plus
Dgri\GH22811-PA 157 GH22811-PA 26..119 28..122 198 43.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:56:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG34012-PA 158 CG34012-PA 1..158 1..158 850 100 Plus
CG34021-PA 161 CG34021-PA 30..128 24..124 199 42.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:06:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11626-PA 156 GI11626-PA 11..156 11..158 583 73.6 Plus
Dmoj\GI21187-PA 159 GI21187-PA 35..125 27..119 220 49.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:06:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22846-PA 155 GL22846-PA 3..155 6..158 633 74.5 Plus
Dper\GL22844-PA 155 GL22844-PA 3..155 6..158 633 74.5 Plus
Dper\GL15304-PA 169 GL15304-PA 28..128 24..126 180 44.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:06:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23890-PA 155 GA23890-PA 3..155 6..158 633 74.5 Plus
Dpse\GA23887-PA 155 GA23887-PA 3..155 6..158 633 74.5 Plus
Dpse\GA29042-PA 169 GA29042-PA 28..141 24..139 185 40.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:06:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24772-PA 158 GM24772-PA 1..158 1..158 829 96.8 Plus
Dsec\GM21361-PA 161 GM21361-PA 30..128 24..124 203 42.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:06:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12823-PA 158 GD12823-PA 1..158 1..158 836 97.5 Plus
Dsim\GD10858-PA 161 GD10858-PA 30..128 24..124 203 42.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:06:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11308-PA 156 GJ11308-PA 4..156 5..158 605 72.9 Plus
Dvir\GJ11307-PA 117 GJ11307-PA 4..117 5..158 427 58.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:06:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20535-PA 154 GK20535-PA 7..154 9..156 606 73.6 Plus
Dwil\GK24509-PA 144 GK24509-PA 3..96 24..119 225 46.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:06:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20236-PA 158 GE20236-PA 1..158 1..158 799 92.4 Plus
Dyak\GE12436-PA 159 GE12436-PA 31..142 24..135 203 41.2 Plus