BDGP Sequence Production Resources |
Search the DGRC for IP21628
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 216 |
Well: | 28 |
Vector: | pOT2 |
Associated Gene/Transcript | CG13877-RC |
Protein status: | IP21628.pep: gold |
Sequenced Size: | 488 |
Gene | Date | Evidence |
---|---|---|
pyx | 2008-05-05 | Release 5.5 slip selected |
488 bp assembled on 2010-01-13
GenBank Submission: BT032819.2
> IP21628.complete TCTGTTCGCCTGTAGCGCTAAAGTCTCCATCATCTATTACCTATTTATTG AGGCTTTGTAAAATTAAAGAAAATGGTTTACATATGCACTCTTGTGGTGT TGATCTTTCCCGTCTTGTTGTTGGGTGCACCATGGGAAGGGTCGCATCCT AAGTCTCAGGTGGAATACATCAGCAACGACAAGAGAGTTGATTCTGGCTT CGCCAACCCCAATATCGTGCCCATCACCCAGCCGTCGGTCGTAACGCAAA CAGCTCCTCCTCCGCCGCCAAATTCCAAAAACTTTGCATATAGTCCGATG ACGCAGAGCTGGACCCTCATTGCGCCAGGCGATCCGCTGCCCAATAATGA CACCCTCGTCTGGAACCAGAGCAATGACAAATGGCTCACTCGCTAAGCAA TGCAACCATCGATGGCTTTGCTTTAATCATTGTGTATTACTATTGAAATA AATATAACTAATTCACTGTAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13877-RB | 508 | CG13877-RB | 42..508 | 1..464 | 2265 | 99.3 | Plus |
CG13877.a | 450 | CG13877.a | 1..450 | 20..469 | 2250 | 100 | Plus |
pyx-RB | 2502 | pyx-RB | 1870..2251 | 470..89 | 1910 | 100 | Minus |
pyx-RB | 2502 | pyx-RB | 2271..2326 | 56..1 | 280 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
accord | 7404 | accord ACCORD 7404bp | 4257..4294 | 446..409 | 109 | 76.3 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 218063..218150 | 1..88 | 100 | -> | Plus |
chr3L | 218238..218618 | 89..469 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13877-RA | 1..324 | 73..396 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13877-RC | 1..324 | 73..396 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13877-RC | 1..324 | 73..396 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13877-RA | 54..324 | 1..271 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13877-RC | 1..324 | 73..396 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13877-RA | 42..437 | 1..396 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13877-RC | 42..510 | 1..469 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13877-RB | 41..507 | 1..464 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
pyx-RA | 3335..3678 | 1..344 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13877-RB | 41..507 | 1..464 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 218108..218195 | 1..88 | 100 | -> | Plus |
3L | 218283..218663 | 89..469 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 218108..218195 | 1..88 | 100 | -> | Plus |
3L | 218283..218663 | 89..469 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 218108..218195 | 1..88 | 100 | -> | Plus |
3L | 218283..218663 | 89..469 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 218108..218195 | 1..88 | 100 | -> | Plus |
arm_3L | 218283..218663 | 89..469 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 218283..218663 | 89..469 | 100 | Plus | |
3L | 218108..218195 | 1..88 | 100 | -> | Plus |
Translation from 72 to 395
> IP21628.pep MVYICTLVVLIFPVLLLGAPWEGSHPKSQVEYISNDKRVDSGFANPNIVP ITQPSVVTQTAPPPPPNSKNFAYSPMTQSWTLIAPGDPLPNNDTLVWNQS NDKWLTR*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG14703-PA | 107 | GG14703-PA | 1..107 | 1..107 | 499 | 89.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH13148-PA | 166 | GH13148-PA | 65..161 | 4..106 | 251 | 54.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13877-PC | 107 | CG13877-PC | 1..107 | 1..107 | 584 | 100 | Plus |
CG13877-PB | 108 | CG13877-PB | 1..108 | 1..107 | 572 | 99.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI17787-PA | 107 | GI17787-PA | 6..102 | 1..106 | 248 | 52.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL16116-PA | 113 | GL16116-PA | 8..110 | 3..106 | 336 | 66.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12593-PB | 108 | GA12593-PB | 1..105 | 1..106 | 330 | 65.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM14319-PA | 107 | GM14319-PA | 1..107 | 1..107 | 533 | 97.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD13557-PA | 107 | GD13557-PA | 1..107 | 1..107 | 527 | 95.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ17613-PA | 107 | GJ17613-PA | 25..103 | 24..107 | 250 | 64.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE21066-PA | 107 | GE21066-PA | 1..107 | 1..107 | 476 | 86 | Plus |
Translation from 72 to 395
> IP21628.hyp MVYICTLVVLIFPVLLLGAPWEGSHPKSQVEYISNDKRVDSGFANPNIVP ITQPSVVTQTAPPPPPNSKNFAYSPMTQSWTLIAPGDPLPNNDTLVWNQS NDKWLTR*