Clone IP21628 Report

Search the DGRC for IP21628

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:216
Well:28
Vector:pOT2
Associated Gene/TranscriptCG13877-RC
Protein status:IP21628.pep: gold
Sequenced Size:488

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
pyx 2008-05-05 Release 5.5 slip selected

Clone Sequence Records

IP21628.complete Sequence

488 bp assembled on 2010-01-13

GenBank Submission: BT032819.2

> IP21628.complete
TCTGTTCGCCTGTAGCGCTAAAGTCTCCATCATCTATTACCTATTTATTG
AGGCTTTGTAAAATTAAAGAAAATGGTTTACATATGCACTCTTGTGGTGT
TGATCTTTCCCGTCTTGTTGTTGGGTGCACCATGGGAAGGGTCGCATCCT
AAGTCTCAGGTGGAATACATCAGCAACGACAAGAGAGTTGATTCTGGCTT
CGCCAACCCCAATATCGTGCCCATCACCCAGCCGTCGGTCGTAACGCAAA
CAGCTCCTCCTCCGCCGCCAAATTCCAAAAACTTTGCATATAGTCCGATG
ACGCAGAGCTGGACCCTCATTGCGCCAGGCGATCCGCTGCCCAATAATGA
CACCCTCGTCTGGAACCAGAGCAATGACAAATGGCTCACTCGCTAAGCAA
TGCAACCATCGATGGCTTTGCTTTAATCATTGTGTATTACTATTGAAATA
AATATAACTAATTCACTGTAAAAAAAAAAAAAAAAAAA

IP21628.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:34:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG13877-RB 508 CG13877-RB 42..508 1..464 2265 99.3 Plus
CG13877.a 450 CG13877.a 1..450 20..469 2250 100 Plus
pyx-RB 2502 pyx-RB 1870..2251 470..89 1910 100 Minus
pyx-RB 2502 pyx-RB 2271..2326 56..1 280 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:27:04
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 218238..218618 89..469 1905 100 Plus
chr3L 24539361 chr3L 218063..218150 1..88 440 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:46:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:27:02
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 218283..218664 89..470 1910 100 Plus
3L 28110227 3L 218108..218195 1..88 440 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:51:09
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 218283..218664 89..470 1910 100 Plus
3L 28103327 3L 218108..218195 1..88 440 100 Plus
Blast to na_te.dros performed 2019-03-16 18:27:03
Subject Length Description Subject Range Query Range Score Percent Strand
accord 7404 accord ACCORD 7404bp 4257..4294 446..409 109 76.3 Minus

IP21628.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:28:02 Download gff for IP21628.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 218063..218150 1..88 100 -> Plus
chr3L 218238..218618 89..469 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-01-13 14:24:16 Download gff for IP21628.complete
Subject Subject Range Query Range Percent Splice Strand
CG13877-RA 1..324 73..396 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:52:27 Download gff for IP21628.complete
Subject Subject Range Query Range Percent Splice Strand
CG13877-RC 1..324 73..396 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:20:02 Download gff for IP21628.complete
Subject Subject Range Query Range Percent Splice Strand
CG13877-RC 1..324 73..396 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:49:39 Download gff for IP21628.complete
Subject Subject Range Query Range Percent Splice Strand
CG13877-RA 54..324 1..271 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:39:53 Download gff for IP21628.complete
Subject Subject Range Query Range Percent Splice Strand
CG13877-RC 1..324 73..396 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-01-13 14:24:10 Download gff for IP21628.complete
Subject Subject Range Query Range Percent Splice Strand
CG13877-RA 42..437 1..396 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:52:26 Download gff for IP21628.complete
Subject Subject Range Query Range Percent Splice Strand
CG13877-RC 42..510 1..469 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:20:02 Download gff for IP21628.complete
Subject Subject Range Query Range Percent Splice Strand
CG13877-RB 41..507 1..464 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:49:40 Download gff for IP21628.complete
Subject Subject Range Query Range Percent Splice Strand
pyx-RA 3335..3678 1..344 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:39:53 Download gff for IP21628.complete
Subject Subject Range Query Range Percent Splice Strand
CG13877-RB 41..507 1..464 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:28:02 Download gff for IP21628.complete
Subject Subject Range Query Range Percent Splice Strand
3L 218108..218195 1..88 100 -> Plus
3L 218283..218663 89..469 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:28:02 Download gff for IP21628.complete
Subject Subject Range Query Range Percent Splice Strand
3L 218108..218195 1..88 100 -> Plus
3L 218283..218663 89..469 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:28:02 Download gff for IP21628.complete
Subject Subject Range Query Range Percent Splice Strand
3L 218108..218195 1..88 100 -> Plus
3L 218283..218663 89..469 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:20:02 Download gff for IP21628.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 218108..218195 1..88 100 -> Plus
arm_3L 218283..218663 89..469 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:28:37 Download gff for IP21628.complete
Subject Subject Range Query Range Percent Splice Strand
3L 218283..218663 89..469 100   Plus
3L 218108..218195 1..88 100 -> Plus

IP21628.pep Sequence

Translation from 72 to 395

> IP21628.pep
MVYICTLVVLIFPVLLLGAPWEGSHPKSQVEYISNDKRVDSGFANPNIVP
ITQPSVVTQTAPPPPPNSKNFAYSPMTQSWTLIAPGDPLPNNDTLVWNQS
NDKWLTR*

IP21628.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:12:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14703-PA 107 GG14703-PA 1..107 1..107 499 89.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:12:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13148-PA 166 GH13148-PA 65..161 4..106 251 54.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:17:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG13877-PC 107 CG13877-PC 1..107 1..107 584 100 Plus
CG13877-PB 108 CG13877-PB 1..108 1..107 572 99.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:12:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17787-PA 107 GI17787-PA 6..102 1..106 248 52.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:12:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16116-PA 113 GL16116-PA 8..110 3..106 336 66.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:12:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12593-PB 108 GA12593-PB 1..105 1..106 330 65.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:12:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14319-PA 107 GM14319-PA 1..107 1..107 533 97.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:12:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13557-PA 107 GD13557-PA 1..107 1..107 527 95.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:12:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17613-PA 107 GJ17613-PA 25..103 24..107 250 64.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:12:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21066-PA 107 GE21066-PA 1..107 1..107 476 86 Plus

IP21628.hyp Sequence

Translation from 72 to 395

> IP21628.hyp
MVYICTLVVLIFPVLLLGAPWEGSHPKSQVEYISNDKRVDSGFANPNIVP
ITQPSVVTQTAPPPPPNSKNFAYSPMTQSWTLIAPGDPLPNNDTLVWNQS
NDKWLTR*

IP21628.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:43:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG13877-PC 107 CG13877-PC 1..107 1..107 584 100 Plus
CG13877-PB 108 CG13877-PB 1..108 1..107 572 99.1 Plus