Clone IP21646 Report

Search the DGRC for IP21646

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:216
Well:46
Vector:pOT2
Associated Gene/TranscriptAcyp-RA
Protein status:IP21646.pep: gold
Sequenced Size:474

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Acyp 2008-05-05 Release 5.5 slip selected
Acyp 2008-08-15 Release 5.9 accounting
Acyp 2008-12-18 5.12 accounting

Clone Sequence Records

IP21646.complete Sequence

474 bp assembled on 2008-05-22

GenBank Submission: BT032993

> IP21646.complete
ATTTCGTCGAAAGTCCCAAAAATTTCCCCATATTGGGAAACGACAGTAGA
GACTTCTTCGCAATGGCGACCCATAATGTCCATTCCTGCGAATTCGAGGT
ATTTGGCCGCGTGCAGGGCGTCAACTTCCGGCGACACGCCCTGCGAAAGG
CCAAGACACTGGGTCTTCGCGGCTGGTGCATGAACTCCAGCAGGGGCACC
GTGAAGGGTTACATCGAAGGTCGTCCGGCCGAGATGGATGTGATGAAGGA
GTGGCTCAGGACGACGGGCAGTCCGCTGTCCAGCATCGAGAAGGTGGAGT
TCAGTTCTCAGCGTGAGCGCGATCGCTATGGCTATGCCAACTTTCATATC
AAGCCCGATCCGCACGAGAATCGCCCAGTTCATGAAGGATTGGGCAGTAG
TTCCAGCCACCATGATAGCAATTAGCGGATTTTTGACGGAACAATAAAAT
TAAATGTGAAAAAAAAAAAAAAAA

IP21646.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:52:09
Subject Length Description Subject Range Query Range Score Percent Strand
Acyp-RA 438 Acyp-RA 1..438 1..438 2190 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:05:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 13910856..13911313 1..458 2275 99.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:46:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:05:58
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13912139..13912601 1..463 2315 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:48:47
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13912139..13912601 1..463 2315 100 Plus
Blast to na_te.dros performed 2019-03-16 09:05:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dbuz\BuT2 2775 Dbuz\BuT2 BUT2 2775bp 2191..2227 458..422 104 75.7 Minus

IP21646.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:07:04 Download gff for IP21646.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 13910856..13911313 1..458 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:26:46 Download gff for IP21646.complete
Subject Subject Range Query Range Percent Splice Strand
Acyp-RA 1..363 63..425 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:38:43 Download gff for IP21646.complete
Subject Subject Range Query Range Percent Splice Strand
Acyp-RA 1..363 63..425 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:00:09 Download gff for IP21646.complete
Subject Subject Range Query Range Percent Splice Strand
Acyp-RA 1..363 63..425 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:44:32 Download gff for IP21646.complete
Subject Subject Range Query Range Percent Splice Strand
Acyp-RA 1..363 63..425 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:59:29 Download gff for IP21646.complete
Subject Subject Range Query Range Percent Splice Strand
Acyp-RA 1..363 63..425 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:08:01 Download gff for IP21646.complete
Subject Subject Range Query Range Percent Splice Strand
Acyp-RA 1..363 63..425 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:38:43 Download gff for IP21646.complete
Subject Subject Range Query Range Percent Splice Strand
Acyp-RA 1..458 1..458 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:00:09 Download gff for IP21646.complete
Subject Subject Range Query Range Percent Splice Strand
Acyp-RA 57..514 1..458 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:44:32 Download gff for IP21646.complete
Subject Subject Range Query Range Percent Splice Strand
Acyp-RA 1..363 63..425 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:59:29 Download gff for IP21646.complete
Subject Subject Range Query Range Percent Splice Strand
Acyp-RA 57..514 1..458 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:07:04 Download gff for IP21646.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13912139..13912596 1..458 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:07:04 Download gff for IP21646.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13912139..13912596 1..458 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:07:04 Download gff for IP21646.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13912139..13912596 1..458 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:00:09 Download gff for IP21646.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 13912139..13912596 1..458 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:21:15 Download gff for IP21646.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13912139..13912596 1..458 100   Plus

IP21646.hyp Sequence

Translation from 2 to 424

> IP21646.hyp
FVESPKNFPILGNDSRDFFAMATHNVHSCEFEVFGRVQGVNFRRHALRKA
KTLGLRGWCMNSSRGTVKGYIEGRPAEMDVMKEWLRTTGSPLSSIEKVEF
SSQRERDRYGYANFHIKPDPHENRPVHEGLGSSSSHHDSN*

IP21646.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:24:30
Subject Length Description Subject Range Query Range Score Percent Strand
Acyp-PB 120 CG16870-PB 1..120 21..140 651 100 Plus
Acyp-PA 120 CG16870-PA 1..120 21..140 651 100 Plus
CG11052-PD 149 CG11052-PD 56..149 26..119 240 48.9 Plus
CG11052-PC 149 CG11052-PC 56..149 26..119 240 48.9 Plus
CG11052-PB 149 CG11052-PB 56..149 26..119 240 48.9 Plus

IP21646.pep Sequence

Translation from 2 to 424

> IP21646.pep
FVESPKNFPILGNDSRDFFAMATHNVHSCEFEVFGRVQGVNFRRHALRKA
KTLGLRGWCMNSSRGTVKGYIEGRPAEMDVMKEWLRTTGSPLSSIEKVEF
SSQRERDRYGYANFHIKPDPHENRPVHEGLGSSSSHHDSN*

IP21646.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:57:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19668-PA 116 GF19668-PA 1..99 21..119 439 77.8 Plus
Dana\GF18541-PA 102 GF18541-PA 6..101 22..117 264 49 Plus
Dana\GF16871-PA 150 GF16871-PA 57..147 26..116 250 51.6 Plus
Dana\GF14085-PA 119 GF14085-PA 26..118 25..117 230 46.2 Plus
Dana\GF12022-PA 108 GF12022-PA 7..99 25..117 199 39.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:57:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23897-PA 119 GG23897-PA 1..119 21..139 568 87.4 Plus
Dere\GG16952-PA 102 GG16952-PA 6..101 22..117 264 52.1 Plus
Dere\GG24762-PA 149 GG24762-PA 56..149 26..119 251 51.1 Plus
Dere\GG10375-PA 124 GG10375-PA 28..123 22..117 237 46.9 Plus
Dere\GG20418-PA 107 GG20418-PA 6..98 25..117 197 41.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:57:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15191-PA 141 GH15191-PA 44..135 25..116 279 52.2 Plus
Dgri\GH18239-PA 96 GH18239-PA 4..95 26..117 255 51.1 Plus
Dgri\GH19786-PA 95 GH19786-PA 2..72 49..119 252 63.4 Plus
Dgri\GH11331-PA 99 GH11331-PA 4..98 23..117 233 48.4 Plus
Dgri\GH11746-PA 124 GH11746-PA 29..123 23..117 231 48.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:00:24
Subject Length Description Subject Range Query Range Score Percent Strand
Acyp-PB 120 CG16870-PB 1..120 21..140 651 100 Plus
Acyp-PA 120 CG16870-PA 1..120 21..140 651 100 Plus
CG11052-PD 149 CG11052-PD 56..149 26..119 240 48.9 Plus
CG11052-PC 149 CG11052-PC 56..149 26..119 240 48.9 Plus
CG11052-PB 149 CG11052-PB 56..149 26..119 240 48.9 Plus
CG11052-PA 149 CG11052-PA 56..149 26..119 240 48.9 Plus
CG34161-PC 125 CG34161-PC 27..124 20..117 237 48 Plus
CG34161-PA 125 CG34161-PA 27..124 20..117 237 48 Plus
Acyp2-PB 102 CG18505-PB 10..101 26..117 226 45.7 Plus
Acyp2-PA 102 CG18505-PA 10..101 26..117 226 45.7 Plus
CG34161-PB 120 CG34161-PB 27..119 20..117 211 46.9 Plus
CG18371-PA 110 CG18371-PA 8..99 26..117 203 43.5 Plus
CG14022-PB 101 CG14022-PB 13..100 30..117 170 37.5 Plus
CG14022-PA 101 CG14022-PA 13..100 30..117 170 37.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:57:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22288-PA 120 GI22288-PA 1..97 21..119 378 71.7 Plus
Dmoj\GI10195-PA 96 GI10195-PA 4..94 26..116 237 46.2 Plus
Dmoj\GI17837-PA 99 GI17837-PA 7..98 26..117 222 48.9 Plus
Dmoj\GI21180-PA 110 GI21180-PA 4..106 22..124 192 38.8 Plus
Dmoj\GI10542-PA 101 GI10542-PA 11..100 28..117 186 38.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:57:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21249-PA 116 GL21249-PA 1..106 21..126 371 61.3 Plus
Dper\GL22235-PA 102 GL22235-PA 10..101 26..117 272 53.3 Plus
Dper\GL26404-PA 132 GL26404-PA 24..116 25..117 232 48.4 Plus
Dper\GL22340-PA 143 GL22340-PA 44..141 20..117 228 40.8 Plus
Dper\GL16721-PA 110 GL16721-PA 4..104 22..122 198 37.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:57:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28779-PA 116 GA28779-PA 1..106 21..126 363 60.4 Plus
Dpse\GA27428-PA 102 GA27428-PA 10..101 26..117 272 53.3 Plus
Dpse\GA28850-PA 117 GA28850-PA 24..116 25..117 234 49.5 Plus
Dpse\GA14909-PA 110 GA14909-PA 4..104 22..122 196 37.6 Plus
Dpse\GA12705-PA 102 GA12705-PA 12..101 28..117 175 35.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:57:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15374-PA 120 GM15374-PA 1..119 21..139 599 94.1 Plus
Dsec\GM11586-PA 124 GM11586-PA 26..123 20..117 247 48 Plus
Dsec\GM10438-PA 149 GM10438-PA 56..149 26..119 243 48.9 Plus
Dsec\GM24259-PA 102 GM24259-PA 9..101 25..117 232 47.3 Plus
Dsec\GM21504-PA 110 GM21504-PA 7..99 25..117 198 41.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:57:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Acyp-PA 120 GD23938-PA 1..119 21..139 599 94.1 Plus
Dsim\GD22242-PA 124 GD22242-PA 26..123 20..117 244 48 Plus
Dsim\GD19440-PA 149 GD19440-PA 56..149 26..119 242 48.9 Plus
Dsim\GD10999-PA 110 GD10999-PA 7..99 25..117 198 41.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:57:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24080-PA 122 GJ24080-PA 4..97 26..119 361 70.2 Plus
Dvir\GJ23483-PA 96 GJ23483-PA 4..95 26..117 251 51.1 Plus
Dvir\GJ17330-PA 99 GJ17330-PA 7..98 26..117 229 48.9 Plus
Dvir\GJ21758-PA 101 GJ21758-PA 11..100 28..117 188 40 Plus
Dvir\GJ21038-PA 111 GJ21038-PA 7..102 25..120 188 39.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:57:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12388-PA 99 GK12388-PA 6..98 25..117 257 47.3 Plus
Dwil\GK14028-PA 139 GK14028-PA 33..139 14..119 240 43 Plus
Dwil\GK15522-PA 126 GK15522-PA 33..125 25..117 236 48.4 Plus
Dwil\GK19418-PA 107 GK19418-PA 5..99 23..117 195 40 Plus
Dwil\GK18433-PA 101 GK18433-PA 13..100 30..117 176 36.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:57:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19011-PA 120 GE19011-PA 1..120 21..140 581 90.8 Plus
Dyak\GE24338-PA 102 GE24338-PA 7..101 23..117 258 50.5 Plus
Dyak\GE25751-PA 149 GE25751-PA 56..149 26..119 244 50 Plus
Dyak\GE13517-PA 124 GE13517-PA 26..123 20..117 243 48 Plus
Dyak\GE12579-PA 110 GE12579-PA 7..99 25..117 197 40.9 Plus