Clone IP21655 Report

Search the DGRC for IP21655

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:216
Well:55
Vector:pOT2
Associated Gene/TranscriptNimB3-RA
Protein status:IP21655.pep: gold
Sequenced Size:470

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34003 2008-05-05 Release 5.5 slip selected
CG34003 2008-08-15 Release 5.9 accounting
nimB3 2008-12-18 5.12 accounting

Clone Sequence Records

IP21655.complete Sequence

470 bp assembled on 2008-05-14

GenBank Submission: BT032994

> IP21655.complete
CGAGCATTGCGCTCGCATTTTGATACGACCTCGCCTTCAGCTGAATCCGA
GCGAAATGCACTTGACATCCACGCTGATTGGACTCCTTATCTGCGGTCTG
GGGATCGAGCTGCCCACGCGCACTGCCGCACAATTCTGGTCGGTGGATCC
TGTTACGCAGTGGCGAAAAGAGGCTCTGGCCGAGAGGGGATCCGGCATCT
GTTACAGGACGCTCACCGTGGAAACCATCAATCCCAACTCCAGAAATCGT
CAGTTCTCCTACTGCTGCGATGGTTATGTGAATAAGGGAACAAGCCAGAA
CCTGAAGTGCGAGCCCATTTGCTCGGAGGACTGCTCCAATGGATTGTGCC
TGGCGCCCGAGGAGTGCGAGTGTGCTCCGGGTTACTATCGGAGTAACAAA
AGGTGTCGTTTTGTCTTGGAATAACAAAAATAAATAATATCAATTACAAA
AAAAAAAAAAAAAAAAAAAA

IP21655.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:00:41
Subject Length Description Subject Range Query Range Score Percent Strand
nimB3-RA 661 nimB3-RA 160..608 1..449 2245 100 Plus
nimB3.a 421 nimB3.a 2..217 1..216 1080 100 Plus
nimB3.a 421 nimB3.a 218..421 244..447 1020 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:25:30
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 13966214..13966444 447..217 1155 100 Minus
chr2L 23010047 chr2L 13966501..13966716 216..1 1080 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:46:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:25:28
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13967462..13967694 449..217 1165 100 Minus
2L 23513712 2L 13967751..13967966 216..1 1080 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:56:31
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13967462..13967694 449..217 1165 100 Minus
2L 23513712 2L 13967751..13967966 216..1 1080 100 Minus
Blast to na_te.dros performed 2019-03-16 00:25:29
Subject Length Description Subject Range Query Range Score Percent Strand
Tabor 7345 Tabor TABOR 7345bp 6465..6499 406..440 103 77.1 Plus

IP21655.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:26:15 Download gff for IP21655.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 13966214..13966444 217..447 100 <- Minus
chr2L 13966501..13966716 1..216 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:26:49 Download gff for IP21655.complete
Subject Subject Range Query Range Percent Splice Strand
nimB3-RA 1..369 56..424 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:56:52 Download gff for IP21655.complete
Subject Subject Range Query Range Percent Splice Strand
nimB3-RA 1..369 56..424 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:35:40 Download gff for IP21655.complete
Subject Subject Range Query Range Percent Splice Strand
NimB3-RA 1..369 56..424 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:55:57 Download gff for IP21655.complete
Subject Subject Range Query Range Percent Splice Strand
CG34003-RA 1..369 56..424 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:00:30 Download gff for IP21655.complete
Subject Subject Range Query Range Percent Splice Strand
NimB3-RA 1..369 56..424 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:21:01 Download gff for IP21655.complete
Subject Subject Range Query Range Percent Splice Strand
nimB3-RA 1..369 56..424 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:56:52 Download gff for IP21655.complete
Subject Subject Range Query Range Percent Splice Strand
nimB3-RA 1..447 1..447 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:35:40 Download gff for IP21655.complete
Subject Subject Range Query Range Percent Splice Strand
NimB3-RA 20..466 1..447 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:55:58 Download gff for IP21655.complete
Subject Subject Range Query Range Percent Splice Strand
CG34003-RA 1..369 56..424 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:00:30 Download gff for IP21655.complete
Subject Subject Range Query Range Percent Splice Strand
NimB3-RA 20..466 1..447 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:26:15 Download gff for IP21655.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13967464..13967694 217..447 100 <- Minus
2L 13967751..13967966 1..216 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:26:15 Download gff for IP21655.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13967464..13967694 217..447 100 <- Minus
2L 13967751..13967966 1..216 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:26:15 Download gff for IP21655.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13967464..13967694 217..447 100 <- Minus
2L 13967751..13967966 1..216 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:35:40 Download gff for IP21655.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 13967751..13967966 1..216 100   Minus
arm_2L 13967464..13967694 217..447 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:33:29 Download gff for IP21655.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13967464..13967694 217..447 100 <- Minus
2L 13967751..13967966 1..216 100   Minus

IP21655.hyp Sequence

Translation from 0 to 423

> IP21655.hyp
EHCARILIRPRLQLNPSEMHLTSTLIGLLICGLGIELPTRTAAQFWSVDP
VTQWRKEALAERGSGICYRTLTVETINPNSRNRQFSYCCDGYVNKGTSQN
LKCEPICSEDCSNGLCLAPEECECAPGYYRSNKRCRFVLE*

IP21655.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:24:32
Subject Length Description Subject Range Query Range Score Percent Strand
NimB3-PA 122 CG34003-PA 1..122 19..140 675 100 Plus
NimB2-PA 421 CG31839-PA 132..209 64..131 160 36.7 Plus

IP21655.pep Sequence

Translation from 1 to 423

> IP21655.pep
EHCARILIRPRLQLNPSEMHLTSTLIGLLICGLGIELPTRTAAQFWSVDP
VTQWRKEALAERGSGICYRTLTVETINPNSRNRQFSYCCDGYVNKGTSQN
LKCEPICSEDCSNGLCLAPEECECAPGYYRSNKRCRFVLE*

IP21655.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:20:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19720-PA 121 GF19720-PA 1..121 19..137 344 57 Plus
Dana\GF15608-PA 421 GF15608-PA 85..211 16..133 142 31 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:20:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10168-PA 122 GG10168-PA 1..121 19..139 599 90.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:20:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10606-PA 124 GH10606-PA 5..123 23..138 343 54.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:49:58
Subject Length Description Subject Range Query Range Score Percent Strand
NimB3-PA 122 CG34003-PA 1..122 19..140 675 100 Plus
NimB2-PA 421 CG31839-PA 132..209 64..131 160 36.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:20:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17396-PA 124 GI17396-PA 1..109 19..128 245 45.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:20:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21065-PA 120 GL21065-PA 1..118 19..136 413 64.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:20:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA29057-PA 120 GA29057-PA 1..118 19..136 413 64.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:20:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15018-PA 123 GM15018-PA 1..123 19..140 607 94.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:20:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22026-PA 123 GD22026-PA 1..123 19..140 607 94.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:20:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18074-PA 122 GJ18074-PA 9..118 27..136 355 58.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:20:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15109-PA 122 GK15109-PA 1..117 14..136 322 50.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:20:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25246-PA 122 GE25246-PA 1..121 19..139 574 87.6 Plus
Dyak\GE25257-PA 420 GE25257-PA 85..210 16..133 140 28.7 Plus