Clone IP21714 Report

Search the DGRC for IP21714

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:217
Well:14
Vector:pOT2
Associated Gene/TranscriptCG30413-RA
Protein status:IP21714.pep: gold
Sequenced Size:525

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30413 2008-04-29 Release 5.5 accounting
CG30413 2008-05-05 Release 5.5 slip selected
CG30413 2008-08-15 Release 5.9 accounting
CG30413 2008-12-18 5.12 accounting

Clone Sequence Records

IP21714.complete Sequence

525 bp assembled on 2008-05-22

GenBank Submission: BT031077

> IP21714.complete
TCTCGTCCCAAAAAAACAACCTCTAAGATGTACCTCTTTGGCGTTTTCCT
GCTCTTGGTCGGCACTCACGTCTGCTTCATCGATGCGAACTTCGGCAGCG
GAGAAGGAAATGACTACACCTACGGCACCCAGGCAACAACGGATACCCTC
ATCGCCAGTGAGACCATAACCAAGTCGAAATCCTTGCTGGGAATCACCAC
GAAGACGTATACTCTAACCCAGGCAGGAACTGCAAAGACCATCACCTACA
TCAAGATCACGGATCTTAAGAAAATGCGTGGAGCCACTGCCGAAATTACC
TCCGGTGGAGTGGGATCCACGACAGTCACGATCAAATTCACCTCTGCACG
GGGAGCTGGTATCAAGTCCCAAGTGGTGATATACGGATCAACCTAAGTGC
ATTCGATCCACTCTCTATTATTTAATTACGAAAGAATTGTGTTCATTTCA
CAACTAGATGATGTTCATCAGTGTCACGTTCATGAAATAAAGATATTTAA
ACTAGAAAAAAAAAAAAAAAAAAAA

IP21714.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:51:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG30413-RA 510 CG30413-RA 1..506 1..506 2530 100 Plus
CG30413.a 441 CG30413.a 158..437 227..506 1400 100 Plus
CG30413.a 441 CG30413.a 1..158 1..158 790 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:12:25
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19215869..19216382 505..1 2340 97.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:46:27 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:12:24
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23329547..23330052 506..1 2530 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:48:36
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23330746..23331251 506..1 2530 100 Minus
Blast to na_te.dros performed on 2019-03-16 06:12:24 has no hits.

IP21714.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:13:21 Download gff for IP21714.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19215869..19216382 1..505 97   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:38:16 Download gff for IP21714.complete
Subject Subject Range Query Range Percent Splice Strand
CG30413-RA 1..369 28..396 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:31:39 Download gff for IP21714.complete
Subject Subject Range Query Range Percent Splice Strand
CG30413-RA 1..369 28..396 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:44:06 Download gff for IP21714.complete
Subject Subject Range Query Range Percent Splice Strand
CG30413-RA 1..369 28..396 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:14:06 Download gff for IP21714.complete
Subject Subject Range Query Range Percent Splice Strand
CG30413-RA 1..369 28..396 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:07:32 Download gff for IP21714.complete
Subject Subject Range Query Range Percent Splice Strand
CG30413-RA 1..369 28..396 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:38:15 Download gff for IP21714.complete
Subject Subject Range Query Range Percent Splice Strand
CG30413-RA 19..523 1..505 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:31:39 Download gff for IP21714.complete
Subject Subject Range Query Range Percent Splice Strand
CG30413-RA 17..521 1..505 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:44:07 Download gff for IP21714.complete
Subject Subject Range Query Range Percent Splice Strand
CG30413-RA 1..369 28..396 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:14:06 Download gff for IP21714.complete
Subject Subject Range Query Range Percent Splice Strand
CG30413-RA 17..521 1..505 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:13:21 Download gff for IP21714.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23329548..23330052 1..505 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:13:21 Download gff for IP21714.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23329548..23330052 1..505 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:13:21 Download gff for IP21714.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23329548..23330052 1..505 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:31:39 Download gff for IP21714.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19217071..19217575 1..505 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:20:56 Download gff for IP21714.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23330765..23331269 1..505 100   Minus

IP21714.pep Sequence

Translation from 0 to 395

> IP21714.pep
SRPKKTTSKMYLFGVFLLLVGTHVCFIDANFGSGEGNDYTYGTQATTDTL
IASETITKSKSLLGITTKTYTLTQAGTAKTITYIKITDLKKMRGATAEIT
SGGVGSTTVTIKFTSARGAGIKSQVVIYGST*

IP21714.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:00:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20011-PA 122 GF20011-PA 25..122 34..131 408 86.7 Plus
Dana\GF20010-PA 117 GF20010-PA 22..116 37..129 165 43.2 Plus
Dana\GF11112-PA 120 GF11112-PA 6..119 17..129 131 34.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:00:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20045-PA 121 GG20045-PA 1..121 10..130 522 95.9 Plus
Dere\GG21920-PA 119 GG21920-PA 3..118 13..129 141 33.9 Plus
Dere\GG18315-PA 85 GG18315-PA 32..84 77..129 139 62.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:00:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20161-PA 122 GH20161-PA 6..122 14..130 293 55.1 Plus
Dgri\GH21960-PA 122 GH21960-PA 10..121 19..129 187 43.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:58:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG30413-PA 122 CG30413-PA 1..122 10..131 610 100 Plus
CG34026-PB 117 CG34026-PB 22..116 37..129 192 48.4 Plus
CG34026-PA 117 CG34026-PA 22..116 37..129 192 48.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:00:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20673-PA 123 GI20673-PA 7..123 16..130 265 62.4 Plus
Dmoj\GI19667-PA 120 GI19667-PA 24..119 36..129 184 46.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:00:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16228-PA 122 GL16228-PA 1..122 10..130 377 75.4 Plus
Dper\GL16227-PA 123 GL16227-PA 14..122 16..129 171 40.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:00:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15559-PA 121 GM15559-PA 1..121 10..130 520 95 Plus
Dsec\GM11373-PA 117 GM11373-PA 22..116 37..129 182 47.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:00:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25061-PA 121 GD25061-PA 1..121 10..130 519 95 Plus
Dsim\GD24776-PA 117 GD24776-PA 22..116 37..129 184 48.4 Plus
Dsim\GD11406-PA 119 GD11406-PA 6..118 17..129 135 33.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:00:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20423-PA 122 GJ20423-PA 6..122 15..130 383 70.9 Plus
Dvir\GJ15031-PA 118 GJ15031-PA 6..117 19..129 191 43.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:00:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21374-PA 146 GK21374-PA 22..104 31..113 264 67.5 Plus
Dwil\GK21373-PA 124 GK21373-PA 8..123 16..129 204 44.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:00:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11581-PA 121 GE11581-PA 1..121 10..130 457 95.9 Plus
Dyak\GE17797-PA 117 GE17797-PA 22..116 37..129 183 47.4 Plus

IP21714.hyp Sequence

Translation from 0 to 395

> IP21714.hyp
SRPKKTTSKMYLFGVFLLLVGTHVCFIDANFGSGEGNDYTYGTQATTDTL
IASETITKSKSLLGITTKTYTLTQAGTAKTITYIKITDLKKMRGATAEIT
SGGVGSTTVTIKFTSARGAGIKSQVVIYGST*

IP21714.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:24:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG30413-PA 122 CG30413-PA 1..122 10..131 610 100 Plus
CG34026-PB 117 CG34026-PB 22..116 37..129 192 48.4 Plus
CG34026-PA 117 CG34026-PA 22..116 37..129 192 48.4 Plus