Clone IP21736 Report

Search the DGRC for IP21736

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:217
Well:36
Vector:pOT2
Associated Gene/TranscriptCG14313-RA
Protein status:IP21736.pep: gold
Sequenced Size:670

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14313 2008-04-29 Release 5.5 accounting
CG14313 2008-05-05 Release 5.5 slip selected
CG14313 2008-08-15 Release 5.9 accounting
CG14313 2008-12-18 5.12 accounting

Clone Sequence Records

IP21736.complete Sequence

670 bp assembled on 2008-05-14

GenBank Submission: BT031078

> IP21736.complete
TTGGTTTGGCTTGGCGCTGCACAAAATCAATAGGTTCAGCAGAAGTGTGT
GGAACCATGCAAATACAGCGAAGTTCATCCGGCGGCTGCTAGCGAGATCA
GTAAATCGAGTACGGCCACCAGACCCATAAATGCGGCAAAGTGGCGTCCT
GTTTTTACACTTGCATGGGTCTGATGCGGACAGTTGGCGGCGCCAGCGAT
GCACAGCTGCCGGAGGAGGCGGTGTCTACGCTCAATCATTGCCCGACCTA
CCGACAGATTCCAGGTGCCGGAACGGGCGCAGGATCAGCGCCAGCCAAGC
GAGTACCCGTCCTGTTTTCCACCAACCGTGGACTCTATCTGCGCCTGGCC
CAACCACTGGCAGATCAGATGGAGGTGATGACACTGCAGCCAAGCGGACA
GAACTACAACATCAGCTTCTGCGATCTGGAGCGCTGGAGCACCAATCGGG
CGAATGTGGTCAGCCTGGAGGACACCTTTAGCATCATGCAGCAGCGCAAT
ATGTCGCCGGAGTCTATGAACTACCAGCCACGCCTGTGGAAGAACAACGT
CAGCTACAGCCTGATGCACTGAACTGAAAGCACCTCAATAGATTATATCT
AAACATTGCAATAGCAGAAGTCTCGTATGTAAATTACAAATTTTTTTACT
TTAAAAAAAAAAAAAAAAAA

IP21736.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:57:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG14313-RA 891 CG14313-RA 240..891 1..652 3260 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:51:17
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 14015856..14016292 437..1 2170 99.8 Minus
chr3R 27901430 chr3R 14015571..14015786 652..437 1065 99.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:46:32 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:51:15
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18191531..18191967 437..1 2185 100 Minus
3R 32079331 3R 18191242..18191459 654..437 1090 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:53:25
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 17932362..17932798 437..1 2185 100 Minus
3R 31820162 3R 17932073..17932290 654..437 1090 100 Minus
Blast to na_te.dros performed on 2019-03-16 16:51:16 has no hits.

IP21736.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:52:11 Download gff for IP21736.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 14015856..14016292 1..437 99   Minus
chr3R 14015571..14015785 438..652 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:27:06 Download gff for IP21736.complete
Subject Subject Range Query Range Percent Splice Strand
CG14313-RA 1..408 165..572 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:49:30 Download gff for IP21736.complete
Subject Subject Range Query Range Percent Splice Strand
CG14313-RA 1..408 165..572 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:25:16 Download gff for IP21736.complete
Subject Subject Range Query Range Percent Splice Strand
CG14313-RA 1..408 165..572 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:48:46 Download gff for IP21736.complete
Subject Subject Range Query Range Percent Splice Strand
CG14313-RA 1..408 165..572 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:45:48 Download gff for IP21736.complete
Subject Subject Range Query Range Percent Splice Strand
CG14313-RA 1..408 165..572 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:12:15 Download gff for IP21736.complete
Subject Subject Range Query Range Percent Splice Strand
CG14313-RA 1..408 165..572 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:49:30 Download gff for IP21736.complete
Subject Subject Range Query Range Percent Splice Strand
CG14313-RA 1..652 1..652 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:25:16 Download gff for IP21736.complete
Subject Subject Range Query Range Percent Splice Strand
CG14313-RA 1..652 1..652 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:48:46 Download gff for IP21736.complete
Subject Subject Range Query Range Percent Splice Strand
CG14313-RA 1..408 165..572 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:45:48 Download gff for IP21736.complete
Subject Subject Range Query Range Percent Splice Strand
CG14313-RA 1..652 1..652 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:52:11 Download gff for IP21736.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18191244..18191458 438..652 100 <- Minus
3R 18191531..18191967 1..437 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:52:11 Download gff for IP21736.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18191244..18191458 438..652 100 <- Minus
3R 18191531..18191967 1..437 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:52:11 Download gff for IP21736.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18191244..18191458 438..652 100 <- Minus
3R 18191531..18191967 1..437 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:25:16 Download gff for IP21736.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14016966..14017180 438..652 100 <- Minus
arm_3R 14017253..14017689 1..437 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:28:27 Download gff for IP21736.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17932075..17932289 438..652 100 <- Minus
3R 17932362..17932798 1..437 100   Minus

IP21736.pep Sequence

Translation from 164 to 571

> IP21736.pep
MGLMRTVGGASDAQLPEEAVSTLNHCPTYRQIPGAGTGAGSAPAKRVPVL
FSTNRGLYLRLAQPLADQMEVMTLQPSGQNYNISFCDLERWSTNRANVVS
LEDTFSIMQQRNMSPESMNYQPRLWKNNVSYSLMH*

IP21736.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:06:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16503-PA 136 GF16503-PA 1..136 1..135 562 77.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:06:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16674-PA 139 GG16674-PA 1..139 1..135 658 91.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:06:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17295-PA 139 GH17295-PA 1..106 1..109 311 61.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:11:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG14313-PA 135 CG14313-PA 1..135 1..135 708 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:06:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23875-PA 140 GI23875-PA 3..109 1..107 305 60.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:06:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12011-PA 135 GL12011-PA 1..135 1..135 567 78.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:06:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12900-PA 135 GA12900-PA 1..135 1..135 567 78.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:06:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15322-PA 139 GM15322-PA 1..139 1..135 667 92.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:06:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20198-PA 139 GD20198-PA 1..139 1..135 667 92.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:06:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23966-PA 65 GJ23966-PA 2..40 74..108 162 82.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:06:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11829-PA 128 GK11829-PA 15..127 20..135 320 59 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:06:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25231-PA 141 GE25231-PA 1..141 1..135 628 87.9 Plus
Dyak\GE11092-PA 106 GE11092-PA 1..105 1..99 408 80 Plus

IP21736.hyp Sequence

Translation from 164 to 571

> IP21736.hyp
MGLMRTVGGASDAQLPEEAVSTLNHCPTYRQIPGAGTGAGSAPAKRVPVL
FSTNRGLYLRLAQPLADQMEVMTLQPSGQNYNISFCDLERWSTNRANVVS
LEDTFSIMQQRNMSPESMNYQPRLWKNNVSYSLMH*

IP21736.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:25:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG14313-PA 135 CG14313-PA 1..135 1..135 708 100 Plus