Clone IP21767 Report

Search the DGRC for IP21767

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:217
Well:67
Vector:pOT2
Associated Gene/TranscriptCG15458-RA
Protein status:IP21767.pep: gold
Sequenced Size:509

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15458 2008-12-18 5.12 accounting

Clone Sequence Records

IP21767.complete Sequence

509 bp assembled on 2008-12-10

GenBank Submission: BT053720.1

> IP21767.complete
AACGTTTAAAAGTCACAATCCGAATCCCGGTCTAAAATACAGGTCGAATA
TCGAATCCAAATTTTAATCTTTTGTTAAAAGCCACGCCAATCCGGTCAAC
AACGATCCAAAGATGTCCGATCATTTCAACTTCAACGAAGCCTTCAACAG
CCAGACCATGCGTGGTCGCGCCAATGTAGCCAAGGCCACCTGGGCCTCGT
TGGGACTCGTCTACGTCCTGGTCAAGATGCACCGCCGCAACACGAAGCGG
CGCGAGACCAAGCTCTACTGCAAGGGCTGCCAGCAGGCCATGCTCCATGG
CTAGGGCGCCGATGCTGCCAAATCATTGAAGTCATGGCTCCCCACCGCTC
CGACCCATTCGACCCGTCAGCAATCCATAACTATTTATAATCAGCACCCC
CTTTCCGGTCCTCGATGCCACAGTTAAAGGCTTGGGGACCAAACTCATGT
ACCACCTCGTTGAGTCAATAAAAATCGAATCCTGCCAAAAAAAAAAAAAA
AAAAAAAAA

IP21767.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:15:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG15458-RA 523 CG15458-RA 32..519 1..488 2440 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:55:44
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 20279123..20279433 486..176 1555 100 Minus
chrX 22417052 chrX 20279493..20279670 178..1 890 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:46:36 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:55:42
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 20413650..20413962 488..176 1565 100 Minus
X 23542271 X 20414022..20414199 178..1 890 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:32:40
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 20398742..20399054 488..176 1565 100 Minus
X 23527363 X 20399114..20399291 178..1 890 100 Minus
Blast to na_te.dros performed on 2019-03-16 02:55:43 has no hits.

IP21767.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:56:18 Download gff for IP21767.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 20279123..20279433 176..486 100 <- Minus
chrX 20279496..20279670 1..175 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:04:04 Download gff for IP21767.complete
Subject Subject Range Query Range Percent Splice Strand
CG15458-RA 1..192 113..304 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:22:06 Download gff for IP21767.complete
Subject Subject Range Query Range Percent Splice Strand
CG15458-RA 1..192 113..304 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:24:14 Download gff for IP21767.complete
Subject Subject Range Query Range Percent Splice Strand
CG15458-RA 1..192 113..304 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:25:36 Download gff for IP21767.complete
Subject Subject Range Query Range Percent Splice Strand
CG15458-RA 1..192 113..304 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-12-10 17:49:38 Download gff for IP21767.complete
Subject Subject Range Query Range Percent Splice Strand
CG15458-RA 1..192 113..304 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:22:06 Download gff for IP21767.complete
Subject Subject Range Query Range Percent Splice Strand
CG15458-RA 1..458 29..486 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:24:14 Download gff for IP21767.complete
Subject Subject Range Query Range Percent Splice Strand
CG15458-RA 1..486 1..486 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:25:36 Download gff for IP21767.complete
Subject Subject Range Query Range Percent Splice Strand
CG15458-RA 1..486 1..486 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:56:18 Download gff for IP21767.complete
Subject Subject Range Query Range Percent Splice Strand
X 20414025..20414199 1..175 100   Minus
X 20413652..20413962 176..486 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:56:18 Download gff for IP21767.complete
Subject Subject Range Query Range Percent Splice Strand
X 20414025..20414199 1..175 100   Minus
X 20413652..20413962 176..486 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:56:18 Download gff for IP21767.complete
Subject Subject Range Query Range Percent Splice Strand
X 20414025..20414199 1..175 100   Minus
X 20413652..20413962 176..486 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:24:14 Download gff for IP21767.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 20284679..20284989 176..486 100 <- Minus
arm_X 20285052..20285226 1..175 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:53:47 Download gff for IP21767.complete
Subject Subject Range Query Range Percent Splice Strand
X 20398744..20399054 176..486 100 <- Minus
X 20399117..20399291 1..175 100   Minus

IP21767.hyp Sequence

Translation from 112 to 303

> IP21767.hyp
MSDHFNFNEAFNSQTMRGRANVAKATWASLGLVYVLVKMHRRNTKRRETK
LYCKGCQQAMLHG*

IP21767.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:25:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG15458-PA 63 CG15458-PA 1..63 1..63 337 100 Plus

IP21767.pep Sequence

Translation from 112 to 303

> IP21767.pep
MSDHFNFNEAFNSQTMRGRANVAKATWASLGLVYVLVKMHRRNTKRRETK
LYCKGCQQAMLHG*

IP21767.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:28:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19491-PA 62 GF19491-PA 1..61 1..61 300 90.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:28:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17993-PA 63 GG17993-PA 1..63 1..63 302 85.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 11:28:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17592-PA 62 GH17592-PA 1..60 1..60 222 68.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:05:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG15458-PA 63 CG15458-PA 1..63 1..63 337 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:28:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16241-PA 62 GI16241-PA 1..61 1..61 253 75.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:28:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26793-PA 63 GL26793-PA 1..61 1..61 189 57.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:28:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13745-PA 63 GA13745-PA 1..61 1..61 188 57.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:28:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22674-PA 63 GM22674-PA 1..63 1..63 296 87.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:28:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24443-PA 63 GD24443-PA 1..63 1..63 318 93.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:28:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15933-PA 62 GJ15933-PA 1..61 1..61 250 73.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:28:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19719-PA 64 GK19719-PA 1..61 1..61 246 72.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:28:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15350-PA 63 GE15350-PA 1..63 1..63 313 90.5 Plus