BDGP Sequence Production Resources |
Search the DGRC for IP21767
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 217 |
Well: | 67 |
Vector: | pOT2 |
Associated Gene/Transcript | CG15458-RA |
Protein status: | IP21767.pep: gold |
Sequenced Size: | 509 |
Gene | Date | Evidence |
---|---|---|
CG15458 | 2008-12-18 | 5.12 accounting |
509 bp assembled on 2008-12-10
GenBank Submission: BT053720.1
> IP21767.complete AACGTTTAAAAGTCACAATCCGAATCCCGGTCTAAAATACAGGTCGAATA TCGAATCCAAATTTTAATCTTTTGTTAAAAGCCACGCCAATCCGGTCAAC AACGATCCAAAGATGTCCGATCATTTCAACTTCAACGAAGCCTTCAACAG CCAGACCATGCGTGGTCGCGCCAATGTAGCCAAGGCCACCTGGGCCTCGT TGGGACTCGTCTACGTCCTGGTCAAGATGCACCGCCGCAACACGAAGCGG CGCGAGACCAAGCTCTACTGCAAGGGCTGCCAGCAGGCCATGCTCCATGG CTAGGGCGCCGATGCTGCCAAATCATTGAAGTCATGGCTCCCCACCGCTC CGACCCATTCGACCCGTCAGCAATCCATAACTATTTATAATCAGCACCCC CTTTCCGGTCCTCGATGCCACAGTTAAAGGCTTGGGGACCAAACTCATGT ACCACCTCGTTGAGTCAATAAAAATCGAATCCTGCCAAAAAAAAAAAAAA AAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15458-RA | 523 | CG15458-RA | 32..519 | 1..488 | 2440 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chrX | 20279123..20279433 | 176..486 | 100 | <- | Minus |
chrX | 20279496..20279670 | 1..175 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15458-RA | 1..192 | 113..304 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15458-RA | 1..192 | 113..304 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15458-RA | 1..192 | 113..304 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15458-RA | 1..192 | 113..304 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15458-RA | 1..192 | 113..304 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15458-RA | 1..458 | 29..486 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15458-RA | 1..486 | 1..486 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15458-RA | 1..486 | 1..486 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 20414025..20414199 | 1..175 | 100 | Minus | |
X | 20413652..20413962 | 176..486 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 20414025..20414199 | 1..175 | 100 | Minus | |
X | 20413652..20413962 | 176..486 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 20414025..20414199 | 1..175 | 100 | Minus | |
X | 20413652..20413962 | 176..486 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_X | 20284679..20284989 | 176..486 | 100 | <- | Minus |
arm_X | 20285052..20285226 | 1..175 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 20398744..20399054 | 176..486 | 100 | <- | Minus |
X | 20399117..20399291 | 1..175 | 100 | Minus |
Translation from 112 to 303
> IP21767.hyp MSDHFNFNEAFNSQTMRGRANVAKATWASLGLVYVLVKMHRRNTKRRETK LYCKGCQQAMLHG*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15458-PA | 63 | CG15458-PA | 1..63 | 1..63 | 337 | 100 | Plus |
Translation from 112 to 303
> IP21767.pep MSDHFNFNEAFNSQTMRGRANVAKATWASLGLVYVLVKMHRRNTKRRETK LYCKGCQQAMLHG*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF19491-PA | 62 | GF19491-PA | 1..61 | 1..61 | 300 | 90.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG17993-PA | 63 | GG17993-PA | 1..63 | 1..63 | 302 | 85.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH17592-PA | 62 | GH17592-PA | 1..60 | 1..60 | 222 | 68.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15458-PA | 63 | CG15458-PA | 1..63 | 1..63 | 337 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI16241-PA | 62 | GI16241-PA | 1..61 | 1..61 | 253 | 75.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL26793-PA | 63 | GL26793-PA | 1..61 | 1..61 | 189 | 57.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA13745-PA | 63 | GA13745-PA | 1..61 | 1..61 | 188 | 57.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM22674-PA | 63 | GM22674-PA | 1..63 | 1..63 | 296 | 87.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD24443-PA | 63 | GD24443-PA | 1..63 | 1..63 | 318 | 93.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ15933-PA | 62 | GJ15933-PA | 1..61 | 1..61 | 250 | 73.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK19719-PA | 64 | GK19719-PA | 1..61 | 1..61 | 246 | 72.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE15350-PA | 63 | GE15350-PA | 1..63 | 1..63 | 313 | 90.5 | Plus |