Clone IP21803 Report

Search the DGRC for IP21803

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:218
Well:3
Vector:pOT2
Associated Gene/TranscriptCG43773-RA
Protein status:IP21803.pep: gold
Sequenced Size:350

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10039 2008-04-29 Release 5.5 accounting
CG10039 2008-05-05 Release 5.5 slip selected
CG10039 2008-08-15 Release 5.9 accounting
CG10039 2008-12-18 5.12 accounting

Clone Sequence Records

IP21803.complete Sequence

350 bp assembled on 2007-11-15

GenBank Submission: BT031230.1

> IP21803.complete
ACAAGACAGAGCCATGTCCGACATCAATATCAACCTCAAGTGCGCCGAGT
GCAACCATCCTCGAGGAGTCCTGTACTATGCAAATCCCCTGGCTTGGGGC
CGTCCTTGTCGCCAGTGCCGCAGGATGATGTCCCGAAATGTTGTGGTTGT
TCCCACTCAGGTTGCAGTTCCAGTTGCTACCAACAACAACATCACCACCA
CTACTACATTTGTACCAGTCGCTGCTGTGTCCACCCAATAAATGGAAAAA
TATGCTCTTCAAAATATAATAAAACTTTTGAGAAATCGAAACAGTAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP21803.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:34:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG10039-RB 296 CG10039-RB 1..296 1..296 1480 100 Plus
CG10039-RA 511 CG10039-RA 43..259 1..217 1085 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:20:45
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 4007124..4007418 1..295 1415 98.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:46:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:20:43
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4007690..4007985 1..296 1480 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:30:27
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4007690..4007985 1..296 1480 100 Plus
Blast to na_te.dros performed on 2019-03-16 11:20:43 has no hits.

IP21803.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:21:22 Download gff for IP21803.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 4007124..4007418 1..295 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:27:14 Download gff for IP21803.complete
Subject Subject Range Query Range Percent Splice Strand
CG10039-RB 1..228 14..241 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:03:18 Download gff for IP21803.complete
Subject Subject Range Query Range Percent Splice Strand
CG10039-RB 1..228 14..241 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:41:41 Download gff for IP21803.complete
Subject Subject Range Query Range Percent Splice Strand
CG43773-RA 1..228 14..241 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:48:38 Download gff for IP21803.complete
Subject Subject Range Query Range Percent Splice Strand
CG10039-RB 1..228 14..241 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:13:21 Download gff for IP21803.complete
Subject Subject Range Query Range Percent Splice Strand
CG43773-RA 1..228 14..241 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 16:52:49 Download gff for IP21803.complete
Subject Subject Range Query Range Percent Splice Strand
CG10039-RB 1..295 1..295 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:03:18 Download gff for IP21803.complete
Subject Subject Range Query Range Percent Splice Strand
CG10039-RB 1..295 1..295 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:41:41 Download gff for IP21803.complete
Subject Subject Range Query Range Percent Splice Strand
CG43773-RA 1..295 1..295 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:48:38 Download gff for IP21803.complete
Subject Subject Range Query Range Percent Splice Strand
CG10039-RB 1..295 1..295 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:13:21 Download gff for IP21803.complete
Subject Subject Range Query Range Percent Splice Strand
CG43773-RA 1..295 1..295 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:21:22 Download gff for IP21803.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4007690..4007984 1..295 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:21:22 Download gff for IP21803.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4007690..4007984 1..295 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:21:22 Download gff for IP21803.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4007690..4007984 1..295 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:41:41 Download gff for IP21803.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4007690..4007984 1..295 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:55:17 Download gff for IP21803.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4007690..4007984 1..295 100   Plus

IP21803.hyp Sequence

Translation from 0 to 294

> IP21803.hyp
TRQSHVRHQYQPQVRRVQPSSRSPVLCKSPGLGPSLSPVPQDDVPKCCGC
SHSGCSSSCYQQQHHHHYYICTSRCCVHPINGKICSSKYNKTFEKSKQ
Sequence IP21803.hyp has no blast hits.

IP21803.pep Sequence

Translation from 1 to 240

> IP21803.pep
QDRAMSDININLKCAECNHPRGVLYYANPLAWGRPCRQCRRMMSRNVVVV
PTQVAVPVATNNNITTTTTFVPVAAVSTQ*

IP21803.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:27:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20690-PA 1407 GF20690-PA 1..42 5..47 170 67.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:27:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24979-PA 135 GG24979-PA 1..49 5..53 257 95.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG43773-PA 75 CG43773-PA 1..75 5..79 401 100 Plus
CG43774-PA 95 CG43774-PA 4..68 5..72 215 62 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 23:28:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17025-PA 1415 GI17025-PA 7..67 10..71 163 51.6 Plus
Dmoj\GI17025-PA 1415 GI17025-PA 70..110 16..56 153 63.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:28:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18451-PA 150 GM18451-PA 1..67 5..72 336 97.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 23:28:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22480-PA 66 GD22480-PA 1..57 5..62 131 65.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:28:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18269-PA 157 GE18269-PA 1..67 5..72 256 88.2 Plus