IP21803.complete Sequence
350 bp assembled on 2007-11-15
GenBank Submission: BT031230.1
> IP21803.complete
ACAAGACAGAGCCATGTCCGACATCAATATCAACCTCAAGTGCGCCGAGT
GCAACCATCCTCGAGGAGTCCTGTACTATGCAAATCCCCTGGCTTGGGGC
CGTCCTTGTCGCCAGTGCCGCAGGATGATGTCCCGAAATGTTGTGGTTGT
TCCCACTCAGGTTGCAGTTCCAGTTGCTACCAACAACAACATCACCACCA
CTACTACATTTGTACCAGTCGCTGCTGTGTCCACCCAATAAATGGAAAAA
TATGCTCTTCAAAATATAATAAAACTTTTGAGAAATCGAAACAGTAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
IP21803.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 16:34:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG10039-RB | 296 | CG10039-RB | 1..296 | 1..296 | 1480 | 100 | Plus |
CG10039-RA | 511 | CG10039-RA | 43..259 | 1..217 | 1085 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:20:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 4007124..4007418 | 1..295 | 1415 | 98.6 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:46:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:20:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 4007690..4007985 | 1..296 | 1480 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:30:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 4007690..4007985 | 1..296 | 1480 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 11:20:43 has no hits.
IP21803.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:21:22 Download gff for
IP21803.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 4007124..4007418 | 1..295 | 98 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:27:14 Download gff for
IP21803.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG10039-RB | 1..228 | 14..241 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:03:18 Download gff for
IP21803.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG10039-RB | 1..228 | 14..241 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:41:41 Download gff for
IP21803.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43773-RA | 1..228 | 14..241 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:48:38 Download gff for
IP21803.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG10039-RB | 1..228 | 14..241 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:13:21 Download gff for
IP21803.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43773-RA | 1..228 | 14..241 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 16:52:49 Download gff for
IP21803.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG10039-RB | 1..295 | 1..295 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:03:18 Download gff for
IP21803.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG10039-RB | 1..295 | 1..295 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:41:41 Download gff for
IP21803.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43773-RA | 1..295 | 1..295 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:48:38 Download gff for
IP21803.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG10039-RB | 1..295 | 1..295 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:13:21 Download gff for
IP21803.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43773-RA | 1..295 | 1..295 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:21:22 Download gff for
IP21803.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 4007690..4007984 | 1..295 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:21:22 Download gff for
IP21803.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 4007690..4007984 | 1..295 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:21:22 Download gff for
IP21803.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 4007690..4007984 | 1..295 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:41:41 Download gff for
IP21803.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 4007690..4007984 | 1..295 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:55:17 Download gff for
IP21803.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 4007690..4007984 | 1..295 | 100 | | Plus |
IP21803.hyp Sequence
Translation from 0 to 294
> IP21803.hyp
TRQSHVRHQYQPQVRRVQPSSRSPVLCKSPGLGPSLSPVPQDDVPKCCGC
SHSGCSSSCYQQQHHHHYYICTSRCCVHPINGKICSSKYNKTFEKSKQ
Sequence IP21803.hyp has no blast hits.
IP21803.pep Sequence
Translation from 1 to 240
> IP21803.pep
QDRAMSDININLKCAECNHPRGVLYYANPLAWGRPCRQCRRMMSRNVVVV
PTQVAVPVATNNNITTTTTFVPVAAVSTQ*
IP21803.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:27:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF20690-PA | 1407 | GF20690-PA | 1..42 | 5..47 | 170 | 67.4 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:27:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG24979-PA | 135 | GG24979-PA | 1..49 | 5..53 | 257 | 95.9 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43773-PA | 75 | CG43773-PA | 1..75 | 5..79 | 401 | 100 | Plus |
CG43774-PA | 95 | CG43774-PA | 4..68 | 5..72 | 215 | 62 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 23:28:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI17025-PA | 1415 | GI17025-PA | 7..67 | 10..71 | 163 | 51.6 | Plus |
Dmoj\GI17025-PA | 1415 | GI17025-PA | 70..110 | 16..56 | 153 | 63.4 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:28:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM18451-PA | 150 | GM18451-PA | 1..67 | 5..72 | 336 | 97.1 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 23:28:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD22480-PA | 66 | GD22480-PA | 1..57 | 5..62 | 131 | 65.5 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:28:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE18269-PA | 157 | GE18269-PA | 1..67 | 5..72 | 256 | 88.2 | Plus |