Clone IP21809 Report

Search the DGRC for IP21809

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:218
Well:9
Vector:pOT2
Associated Gene/TranscriptSt3-RD
Protein status:IP21809.pep: wuzgold
Sequenced Size:1326

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11293 2008-04-29 Release 5.5 accounting
CG11293 2008-05-05 Release 5.5 slip selected
CG11293 2008-08-15 Release 5.9 accounting
CG11293 2008-12-18 5.12 accounting

Clone Sequence Records

IP21809.complete Sequence

1326 bp assembled on 2007-11-15

GenBank Submission: BT031231

> IP21809.complete
ATGCCAAACACATATCTTTGGTGCGAATCTGCGAGCGATTTCAGCCTGTT
TTGTTTGTTACCGTGGGAGTCGTGGGATTTGAAGACTCAGACTCAGCCTG
TGATTACGATGATGGTGACCCAAAGAAGATTCCATTAGTCACTGCTCAGA
CAGGCCTTTTTCGGAGTTCAAATGATAGTGTTTCCGATTGTTTGTTCCAG
AAGCAACACACATATGGACTGGCCCTGTAGTGGATTGTGTACCCAACACA
GCCAAACAAACAGTGAGGCAATCACCCTTCGAAATGGGCCAAAAGCACAC
CAACACCAGTGCAGCAGTGCATGCACTCGATGGCTGTGTGTGCGTGTGAA
AGTAGTGAAAGCTGAAAGCCGAGGGCGAACGGGGCCAATACTTATGCTTA
TGCAAGGCAGCCGAGATGCCGAGATGCCGACGCCACCGCCCCAAAGGGAG
GCCAAAAACGGAAAACAGGCGACATTCATCGCAGGACGTGAAGTGTTCAC
TGTACTTTGGGAGCGGAGGATAAGTCAAGACGTCAACAGAGGAAGCTGTA
CGATGTTCGCCCCCCACTCGCTGCCCGTGACGTCACGACTGTTGCTTCTG
GTGGTGACACTGCTCTTCTGCCCCGTGCAGGCGCATCTCTCGAAGCGAAG
CTACTCGGATCAGAGTGTCCACGGCTACATGACCGAGCGCACCTGCTGGT
GGAACGAGGTGTGTAAGGAGGAGTTCCAGAGCCTCTTCCGCTGCAAGTGC
CCCCAGTTCTCCTACTGCCGCTCGCCGGGACGCTACTACAATGCCTACTG
CTCGATGACGGATACCGGTTATATTTGGACCCAGCCGAACTGGGATTGGG
GGGCGTAGGATGAAGCCGCTCCGGACTTTGCCCCCGCCACGCCCCCTCAC
CAACAACACAGCTCGCTGTGACGTCAAACACACTGACTGCCGACCAAACG
CCTCCGCAAGCCAAACGAAAATTATTCCAGGAGGATACCCACTTGGAGCC
TCCTGCTCAGCCTCCAAAAATACTCTAGTGGAGATGGGCTAGTCTCCCTC
GTTGTTATCGCACCTCGCGCTGACTAAAAAGTACCAAGTGTCGCGTTACT
TTTCGCACGCACTGTTTCCGCGCTGCTGTTGGAAAATCAATATAGGCTTT
CCAATTCACGACGGCTTGTGGCAGGGCCACAGTGAAACCGAAACGACTAG
TTCTGCACGTTTTTAAGTTACATTAAAAGAAACCATAAGATGTTAAATTT
AATAATATTTATATTTATACGTTCCTAGCACTTTTTTAATAAATTTATTC
GAGACTAGAAAAAAAAAAAAAAAAAA

IP21809.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:34:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG11293-RB 1319 CG11293-RB 1..1309 1..1309 6545 100 Plus
CG11293-RA 1219 CG11293-RA 116..1209 216..1309 5470 100 Plus
CG11293.a 1434 CG11293.a 1..770 1..770 3850 100 Plus
CG11293.a 1434 CG11293.a 885..1424 770..1309 2700 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:31:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19573605..19574143 770..1308 2590 98.7 Plus
chr2R 21145070 chr2R 19572704..19573051 217..555 1510 96.3 Plus
chr2R 21145070 chr2R 19571860..19572072 1..216 985 98.1 Plus
chr2R 21145070 chr2R 19573206..19573338 555..687 665 100 Plus
chr2R 21145070 chr2R 19573406..19573490 686..770 410 98.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:46:42 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:31:42
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23687431..23687970 770..1309 2700 100 Plus
2R 25286936 2R 23686538..23686877 216..555 1700 100 Plus
2R 25286936 2R 23685679..23685894 1..216 1080 100 Plus
2R 25286936 2R 23687032..23687164 555..687 665 100 Plus
2R 25286936 2R 23687232..23687316 686..770 425 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:30:28
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23688630..23689169 770..1309 2700 100 Plus
2R 25260384 2R 23687737..23688076 216..555 1700 100 Plus
2R 25260384 2R 23686878..23687093 1..216 1080 100 Plus
2R 25260384 2R 23688231..23688363 555..687 665 100 Plus
2R 25260384 2R 23688431..23688515 686..770 425 100 Plus
Blast to na_te.dros performed on 2019-03-16 15:31:42 has no hits.

IP21809.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:32:31 Download gff for IP21809.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19571860..19572071 1..215 98 -> Plus
chr2R 19572703..19573051 216..555 95 -> Plus
chr2R 19573207..19573338 556..687 100 -> Plus
chr2R 19573408..19573490 688..770 98 -> Plus
chr2R 19573606..19574143 771..1308 93   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:27:22 Download gff for IP21809.complete
Subject Subject Range Query Range Percent Splice Strand
CG11293-RA 1..459 400..858 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:03:19 Download gff for IP21809.complete
Subject Subject Range Query Range Percent Splice Strand
CG11293-RB 1..687 172..858 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:47:32 Download gff for IP21809.complete
Subject Subject Range Query Range Percent Splice Strand
St3-RD 1..687 172..858 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:48:39 Download gff for IP21809.complete
Subject Subject Range Query Range Percent Splice Strand
CG11293-RA 1..459 400..858 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:48:16 Download gff for IP21809.complete
Subject Subject Range Query Range Percent Splice Strand
St3-RC 939..1581 216..858 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 16:52:53 Download gff for IP21809.complete
Subject Subject Range Query Range Percent Splice Strand
CG11293-RA 1..609 400..1008 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:03:19 Download gff for IP21809.complete
Subject Subject Range Query Range Percent Splice Strand
CG11293-RB 1..1308 1..1308 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:47:32 Download gff for IP21809.complete
Subject Subject Range Query Range Percent Splice Strand
St3-RD 1..1308 1..1308 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:48:40 Download gff for IP21809.complete
Subject Subject Range Query Range Percent Splice Strand
CG11293-RA 1..609 400..1008 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:48:16 Download gff for IP21809.complete
Subject Subject Range Query Range Percent Splice Strand
St3-RC 959..2051 216..1308 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:32:31 Download gff for IP21809.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23687033..23687164 556..687 100 -> Plus
2R 23687234..23687316 688..770 100 -> Plus
2R 23685679..23685893 1..215 100 -> Plus
2R 23686538..23686877 216..555 100 -> Plus
2R 23687432..23687969 771..1308 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:32:31 Download gff for IP21809.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23687033..23687164 556..687 100 -> Plus
2R 23687234..23687316 688..770 100 -> Plus
2R 23685679..23685893 1..215 100 -> Plus
2R 23686538..23686877 216..555 100 -> Plus
2R 23687432..23687969 771..1308 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:32:31 Download gff for IP21809.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23687033..23687164 556..687 100 -> Plus
2R 23687234..23687316 688..770 100 -> Plus
2R 23685679..23685893 1..215 100 -> Plus
2R 23686538..23686877 216..555 100 -> Plus
2R 23687432..23687969 771..1308 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:47:32 Download gff for IP21809.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19573202..19573416 1..215 100 -> Plus
arm_2R 19574061..19574400 216..555 100 -> Plus
arm_2R 19574556..19574687 556..687 100 -> Plus
arm_2R 19574757..19574839 688..770 100 -> Plus
arm_2R 19574955..19575492 771..1308 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:55:19 Download gff for IP21809.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23686896..23687110 1..215 100 -> Plus
2R 23687755..23688094 216..555 100 -> Plus
2R 23688250..23688381 556..687 100 -> Plus
2R 23688451..23688533 688..770 100 -> Plus
2R 23688649..23689186 771..1308 100   Plus

IP21809.pep Sequence

Translation from 171 to 857

> IP21809.pep
MIVFPIVCSRSNTHMDWPCSGLCTQHSQTNSEAITLRNGPKAHQHQCSSA
CTRWLCVRVKVVKAESRGRTGPILMLMQGSRDAEMPTPPPQREAKNGKQA
TFIAGREVFTVLWERRISQDVNRGSCTMFAPHSLPVTSRLLLLVVTLLFC
PVQAHLSKRSYSDQSVHGYMTERTCWWNEVCKEEFQSLFRCKCPQFSYCR
SPGRYYNAYCSMTDTGYIWTQPNWDWGA*

IP21809.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:29:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13073-PA 106 GF13073-PA 30..106 152..228 420 97.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:29:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22876-PA 101 GG22876-PA 1..101 128..228 535 97 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:29:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20344-PA 92 GH20344-PA 17..84 153..221 353 92.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:21:12
Subject Length Description Subject Range Query Range Score Percent Strand
St3-PC 526 CG44167-PC 314..526 16..228 1191 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:29:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20013-PA 121 GI20013-PA 32..113 140..221 353 78 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:29:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16879-PA 59 GL16879-PA 1..59 170..228 326 96.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:29:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10895-PB 110 GA10895-PB 8..110 134..228 438 80.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:29:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16036-PA 147 GM16036-PA 1..147 85..228 672 93.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:29:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11784-PA 147 GD11784-PA 1..147 85..228 678 93.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:29:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21261-PA 112 GJ21261-PA 37..104 153..221 341 89.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:29:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23069-PA 120 GK23069-PA 26..119 134..227 411 84 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:29:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14314-PA 147 GE14314-PA 1..147 85..228 674 91.2 Plus

IP21809.hyp Sequence

Translation from 171 to 857

> IP21809.hyp
MIVFPIVCSRSNTHMDWPCSGLCTQHSQTNSEAITLRNGPKAHQHQCSSA
CTRWLCVRVKVVKAESRGRTGPILMLMQGSRDAEMPTPPPQREAKNGKQA
TFIAGREVFTVLWERRISQDVNRGSCTMFAPHSLPVTSRLLLLVVTLLFC
PVQAHLSKRSYSDQSVHGYMTERTCWWNEVCKEEFQSLFRCKCPQFSYCR
SPGRYYNAYCSMTDTGYIWTQPNWDWGA*

IP21809.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:16:32
Subject Length Description Subject Range Query Range Score Percent Strand
St3-PC 526 CG44167-PC 314..526 16..228 1191 100 Plus