Clone IP21814 Report

Search the DGRC for IP21814

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:218
Well:14
Vector:pOT2
Associated Gene/TranscriptCG11841-RA
Protein status:IP21814.pep: gold
Sequenced Size:1092

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11841 2008-05-05 Release 5.5 slip selected
CG11841 2008-08-15 Release 5.9 accounting
CG11841 2008-12-18 5.12 accounting

Clone Sequence Records

IP21814.complete Sequence

1092 bp assembled on 2008-05-14

GenBank Submission: BT033000

> IP21814.complete
CTGCAGTTCAATAGGATGGCCATGCAATCGCTAGAATTGATATTACTGCT
AGTGTTTTCACTCAGCAGCAGCCTTGTTCAGGGCCAAAATCCGGATCCAT
TTGCCCAGCTTGCTTGCACGAAGTTCAAGCAGATTGTCTTCGAAGAGCGC
GTGGCCATTAGCTTCTTTTTCACCGATGCACCCATTACCTACGAGACAGT
GGATTCCTGCCATGGATCCAGACCCCTGATTGTGGACGGCACGCCGGCGG
AACCCAAGGAATTTCCATTTGCCGCTCGCCTCGGCCATCGGAAAACTAAC
AATGAAATAAAATGGTTCTGTGGCGGCACCTTGATAAGCAATCGCCTGGT
GCTCACAGCGGCTCACTGCTTTTTTTCCGAACACGGTGAGGTCAACGTTG
TGCGCTTGGGTGAACTGGAGTTCGATACCGACACGGATGACGCGGAACCC
GAGGACTTTGGCGTGCTCGCTCTGAAGGCACATCCTGGCTTCGAGAACCC
GCAACTCTACAATGACATTGGCATAGTTCAGCTGGATCGCGAGGTCAAGT
TCAATAGGTACAAGCATCCTGCCTGCCTGCCCTTCGACGACGGCGAGCAG
CACGAGTCCTTCATCGCCATCGGCTGGGGCCAGAAGAAGTTTGCCCAGAA
GGAGTCAAAGAAGCTGTTGAAGGTGCAGCTCCAGGGCTATAAGGACCGAT
GTGTCAGCAGTGTGGATGCGAATGATGAGTTGCCCAATGGCTACGAGCCC
AAGAGCCAGCTGTGCATCGGATCAAGGGACAACAAGGACACATGCAACGG
CGACTCTGGCGGTCCAGTGCTGGCCTATCACAAGGATCTCGCCTGCATGT
ACCACGTAATGGGCATCACCTCAGCCGGCATCACCTGCTCCACGCCCGAC
ATTCCAAGTGCCTACACGCGGGTGCACTACTTCCTCAACTGGATCAAGGG
CGAACTGGCCAAGCAGACGCAGTGAATGACATGATTGTTTTTAAATTCGT
TTAATCTCTTACACTTGAGACCCTGGGCTGGGTTCTGAGAAAGCCAGAAA
TATACAAGTTATTAATTAATGATTGTAAAAAAAAAAAAAAAA

IP21814.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:59:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG11841-RA 1281 CG11841-RA 148..1226 1..1079 5395 100 Plus
CG11842-RA 1299 CG11842-RA 877..990 756..869 225 79.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:51:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 24874519..24875211 384..1076 3450 99.9 Plus
chr3R 27901430 chr3R 24874165..24874436 112..383 1360 100 Plus
chr3R 27901430 chr3R 24874000..24874111 1..112 530 98.2 Plus
chr3R 27901430 chr3R 24876507..24876620 756..869 225 79.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:46:44 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:51:46
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29051575..29052270 384..1079 3480 100 Plus
3R 32079331 3R 29051221..29051492 112..383 1360 100 Plus
3R 32079331 3R 29051056..29051167 1..112 560 100 Plus
3R 32079331 3R 29053563..29053676 756..869 225 79.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:55:14
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 28792406..28793101 384..1079 3480 100 Plus
3R 31820162 3R 28792052..28792323 112..383 1360 100 Plus
3R 31820162 3R 28791887..28791998 1..112 560 100 Plus
3R 31820162 3R 28794394..28794507 756..869 225 79.8 Plus
Blast to na_te.dros performed on 2019-03-16 16:51:46 has no hits.

IP21814.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:52:26 Download gff for IP21814.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 24874000..24874111 1..112 98 -> Plus
chr3R 24874166..24874436 113..383 100 -> Plus
chr3R 24874519..24875211 384..1076 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:27:27 Download gff for IP21814.complete
Subject Subject Range Query Range Percent Splice Strand
CG11841-RA 1..960 16..975 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:53:57 Download gff for IP21814.complete
Subject Subject Range Query Range Percent Splice Strand
CG11841-RA 1..960 16..975 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:25:29 Download gff for IP21814.complete
Subject Subject Range Query Range Percent Splice Strand
CG11841-RA 1..960 16..975 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:53:11 Download gff for IP21814.complete
Subject Subject Range Query Range Percent Splice Strand
CG11841-RA 1..960 16..975 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:46:12 Download gff for IP21814.complete
Subject Subject Range Query Range Percent Splice Strand
CG11841-RA 1..960 16..975 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:17:06 Download gff for IP21814.complete
Subject Subject Range Query Range Percent Splice Strand
CG11841-RA 1..1061 16..1076 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:53:56 Download gff for IP21814.complete
Subject Subject Range Query Range Percent Splice Strand
CG11841-RA 1..1076 1..1076 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:25:29 Download gff for IP21814.complete
Subject Subject Range Query Range Percent Splice Strand
CG11841-RA 1..1076 1..1076 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:53:11 Download gff for IP21814.complete
Subject Subject Range Query Range Percent Splice Strand
CG11841-RA 1..1061 16..1076 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:46:12 Download gff for IP21814.complete
Subject Subject Range Query Range Percent Splice Strand
CG11841-RA 1..1076 1..1076 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:52:26 Download gff for IP21814.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29051056..29051167 1..112 100 -> Plus
3R 29051222..29051492 113..383 100 -> Plus
3R 29051575..29052267 384..1076 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:52:26 Download gff for IP21814.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29051056..29051167 1..112 100 -> Plus
3R 29051222..29051492 113..383 100 -> Plus
3R 29051575..29052267 384..1076 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:52:26 Download gff for IP21814.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29051056..29051167 1..112 100 -> Plus
3R 29051222..29051492 113..383 100 -> Plus
3R 29051575..29052267 384..1076 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:25:29 Download gff for IP21814.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 24876778..24876889 1..112 100 -> Plus
arm_3R 24876944..24877214 113..383 100 -> Plus
arm_3R 24877297..24877989 384..1076 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:31:24 Download gff for IP21814.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28791887..28791998 1..112 100 -> Plus
3R 28792053..28792323 113..383 100 -> Plus
3R 28792406..28793098 384..1076 100   Plus

IP21814.pep Sequence

Translation from 0 to 974

> IP21814.pep
LQFNRMAMQSLELILLLVFSLSSSLVQGQNPDPFAQLACTKFKQIVFEER
VAISFFFTDAPITYETVDSCHGSRPLIVDGTPAEPKEFPFAARLGHRKTN
NEIKWFCGGTLISNRLVLTAAHCFFSEHGEVNVVRLGELEFDTDTDDAEP
EDFGVLALKAHPGFENPQLYNDIGIVQLDREVKFNRYKHPACLPFDDGEQ
HESFIAIGWGQKKFAQKESKKLLKVQLQGYKDRCVSSVDANDELPNGYEP
KSQLCIGSRDNKDTCNGDSGGPVLAYHKDLACMYHVMGITSAGITCSTPD
IPSAYTRVHYFLNWIKGELAKQTQ*

IP21814.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:47:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16272-PA 313 GF16272-PA 2..313 11..323 1214 71.2 Plus
Dana\GF16273-PA 323 GF16273-PA 12..322 11..321 907 54.4 Plus
Dana\GF16274-PA 314 GF16274-PA 19..313 28..321 811 51.5 Plus
Dana\GF13554-PA 363 GF13554-PA 102..357 73..316 481 39.7 Plus
Dana\GF11395-PA 359 GF11395-PA 91..353 65..316 473 41.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:47:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11636-PA 320 GG11636-PA 1..320 6..324 1645 95.3 Plus
Dere\GG11637-PA 318 GG11637-PA 11..318 11..322 980 58.1 Plus
Dere\GG11638-PA 312 GG11638-PA 24..312 31..321 814 53.1 Plus
Dere\GG11639-PA 334 GG11639-PA 17..332 6..320 811 48.7 Plus
Dere\GG11232-PA 238 GG11232-PA 1..234 90..321 764 61.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:47:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18677-PA 317 GH18677-PA 9..316 14..322 1072 63.9 Plus
Dgri\GH18679-PA 328 GH18679-PA 13..326 8..321 950 56 Plus
Dgri\GH18678-PA 325 GH18678-PA 13..323 8..321 916 55.4 Plus
Dgri\GH18680-PA 287 GH18680-PA 1..286 37..322 849 55.4 Plus
Dgri\GH21187-PA 368 GH21187-PA 97..362 64..316 508 41.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:59:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG11841-PA 319 CG11841-PA 1..319 6..324 1706 100 Plus
CG11842-PA 319 CG11842-PA 35..318 39..321 967 61.6 Plus
CG11843-PB 316 CG11843-PB 12..314 21..320 811 51.5 Plus
CG11843-PA 316 CG11843-PA 12..314 21..320 811 51.5 Plus
CG4927-PC 362 CG4927-PC 76..356 47..316 490 38.3 Plus
CG3700-PA 360 CG3700-PA 89..354 64..316 477 39.7 Plus
snk-PB 435 CG7996-PB 179..434 70..322 389 36.7 Plus
snk-PA 435 CG7996-PA 179..434 70..322 389 36.7 Plus
spirit-PD 393 CG2056-PD 132..363 77..317 327 36.6 Plus
spirit-PC 393 CG2056-PC 132..363 77..317 327 36.6 Plus
spirit-PA 393 CG2056-PA 132..363 77..317 327 36.6 Plus
spirit-PB 393 CG2056-PB 132..363 77..317 327 36.6 Plus
CG14642-PC 392 CG14642-PC 150..387 83..316 326 33.3 Plus
CG14642-PB 392 CG14642-PB 150..387 83..316 326 33.3 Plus
CG11670-PD 404 CG11670-PD 151..389 85..315 325 33.5 Plus
CG9372-PA 408 CG9372-PA 172..402 75..315 324 36.3 Plus
Hayan-PA 378 CG6361-PA 118..370 72..317 310 34.6 Plus
Hayan-PD 637 CG6361-PD 377..629 72..317 310 34.6 Plus
Hayan-PB 637 CG6361-PB 377..629 72..317 310 34.6 Plus
CG1299-PB 442 CG1299-PB 192..434 77..315 304 32 Plus
CG1299-PA 511 CG1299-PA 261..503 77..315 304 32 Plus
CG8738-PA 459 CG8738-PA 212..450 87..321 302 32.5 Plus
Sp7-PF 391 CG3066-PF 131..385 71..315 291 31.3 Plus
Sp7-PE 391 CG3066-PE 131..385 71..315 291 31.3 Plus
Sp7-PA 391 CG3066-PA 131..385 71..315 291 31.3 Plus
CG7432-PB 721 CG7432-PB 475..716 77..316 287 29.8 Plus
psh-PA 394 CG6367-PA 144..386 77..317 285 33.3 Plus
CG4998-PA 891 CG4998-PA 642..884 75..316 284 31.3 Plus
CG4998-PB 1185 CG4998-PB 936..1178 75..316 284 31.3 Plus
CG5909-PA 381 CG5909-PA 118..380 66..319 283 30.5 Plus
CG9733-PB 417 CG9733-PB 156..412 72..316 276 31.1 Plus
CG9733-PA 418 CG9733-PA 157..413 72..316 276 31.1 Plus
grass-PA 335 CG5896-PA 89..331 89..320 271 29.9 Plus
grass-PB 377 CG5896-PB 131..373 89..320 271 29.9 Plus
CG11313-PC 367 CG11313-PC 116..361 77..315 270 30.7 Plus
ea-PA 392 CG4920-PA 128..390 77..319 269 29.1 Plus
CG4914-PA 374 CG4914-PA 128..360 77..315 268 33.3 Plus
ea-PB 261 CG4920-PB 7..259 87..319 266 29.5 Plus
MP1-PA 390 CG1102-PA 128..388 77..319 264 31.3 Plus
MP1-PC 399 CG1102-PC 137..397 77..319 264 31.3 Plus
MP1-PE 400 CG1102-PE 138..398 77..319 264 31.3 Plus
l(2)k05911-PC 639 CG31728-PC 400..634 77..315 263 33.9 Plus
CG8172-PD 371 CG8172-PD 152..367 104..320 262 30.8 Plus
CG8172-PE 545 CG8172-PE 326..541 104..320 262 30.8 Plus
CG8172-PF 561 CG8172-PF 342..557 104..320 262 30.8 Plus
CG11313-PD 370 CG11313-PD 116..364 77..315 261 30.4 Plus
CG4386-PA 372 CG4386-PA 127..360 77..322 261 31.7 Plus
CG11668-PA 398 CG11668-PA 144..396 73..319 257 29.2 Plus
CG30088-PB 281 CG30088-PB 18..273 45..316 256 33.2 Plus
CG31220-PB 363 CG31220-PB 104..361 77..319 256 29.4 Plus
CG3355-PA 314 CG3355-PA 76..307 77..320 252 28.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:47:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24188-PA 316 GI24188-PA 9..316 15..323 1099 64.1 Plus
Dmoj\GI24189-PA 327 GI24189-PA 43..325 38..321 997 60.9 Plus
Dmoj\GI24190-PA 315 GI24190-PA 29..313 39..320 924 57.9 Plus
Dmoj\GI20473-PA 368 GI20473-PA 96..362 64..316 493 39.3 Plus
Dmoj\GI19100-PA 358 GI19100-PA 95..352 69..316 477 39.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:47:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24251-PA 317 GL24251-PA 1..317 6..323 1251 70.4 Plus
Dper\GL24254-PA 316 GL24254-PA 19..316 27..321 859 53.7 Plus
Dper\GL17283-PA 349 GL17283-PA 86..343 69..316 517 42.8 Plus
Dper\GL10135-PA 358 GL10135-PA 93..352 65..316 492 39.7 Plus
Dper\GL24252-PA 183 GL24252-PA 34..181 38..185 491 59.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:47:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11228-PA 317 GA11228-PA 1..317 6..323 1257 70.8 Plus
Dpse\GA11229-PA 319 GA11229-PA 16..319 16..323 1004 59.1 Plus
Dpse\GA11230-PA 315 GA11230-PA 3..314 11..321 866 52.9 Plus
Dpse\GA18531-PA 366 GA18531-PA 99..360 65..316 523 42.2 Plus
Dpse\GA17623-PA 358 GA17623-PA 93..352 65..316 491 39.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:47:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12758-PA 319 GM12758-PA 1..319 6..324 1709 99.4 Plus
Dsec\GM12760-PA 319 GM12760-PA 16..319 15..322 983 59.2 Plus
Dsec\GM12762-PA 316 GM12762-PA 1..314 8..320 813 49.1 Plus
Dsec\GM26534-PA 239 GM26534-PA 1..234 90..321 785 62.8 Plus
Dsec\GM12761-PA 378 GM12761-PA 184..378 129..322 647 59.5 Plus
Dsec\GM12761-PA 378 GM12761-PA 3..175 52..224 524 56.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:47:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21407-PA 319 GD21407-PA 1..319 6..324 1705 99.1 Plus
Dsim\GD21042-PA 282 GD21042-PA 27..277 73..321 844 62.5 Plus
Dsim\GD21409-PA 235 GD21409-PA 2..233 92..320 674 54.7 Plus
Dsim\GD11206-PA 362 GD11206-PA 76..356 47..316 472 38.3 Plus
Dsim\GD11722-PA 360 GD11722-PA 89..354 64..316 472 39.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:47:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10535-PA 317 GJ10535-PA 9..315 15..321 1050 61.4 Plus
Dvir\GJ10536-PA 324 GJ10536-PA 18..322 14..321 941 54.5 Plus
Dvir\GJ10537-PA 314 GJ10537-PA 5..312 14..320 938 55.7 Plus
Dvir\GJ22323-PA 365 GJ22323-PA 94..359 64..316 517 40.2 Plus
Dvir\GJ22231-PA 372 GJ22231-PA 109..366 69..316 502 41.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:47:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22568-PA 320 GK22568-PA 5..318 16..321 1114 64 Plus
Dwil\GK22569-PA 313 GK22569-PA 13..301 35..320 997 60.6 Plus
Dwil\GK19113-PA 307 GK19113-PA 26..307 38..322 939 59.9 Plus
Dwil\GK22566-PA 232 GK22566-PA 4..224 101..321 850 66.1 Plus
Dwil\GK16800-PA 330 GK16800-PA 68..324 72..316 530 43 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:47:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23826-PA 323 GE23826-PA 1..320 6..324 1571 93.8 Plus
Dyak\GE23828-PA 319 GE23828-PA 12..319 11..322 980 58.5 Plus
Dyak\GE23829-PA 297 GE23829-PA 10..297 35..322 860 55 Plus
Dyak\GE23830-PA 316 GE23830-PA 1..314 8..320 841 50.6 Plus
Dyak\GE10399-PA 202 GE10399-PA 1..198 90..321 591 53 Plus

IP21814.hyp Sequence

Translation from 0 to 974

> IP21814.hyp
LQFNRMAMQSLELILLLVFSLSSSLVQGQNPDPFAQLACTKFKQIVFEER
VAISFFFTDAPITYETVDSCHGSRPLIVDGTPAEPKEFPFAARLGHRKTN
NEIKWFCGGTLISNRLVLTAAHCFFSEHGEVNVVRLGELEFDTDTDDAEP
EDFGVLALKAHPGFENPQLYNDIGIVQLDREVKFNRYKHPACLPFDDGEQ
HESFIAIGWGQKKFAQKESKKLLKVQLQGYKDRCVSSVDANDELPNGYEP
KSQLCIGSRDNKDTCNGDSGGPVLAYHKDLACMYHVMGITSAGITCSTPD
IPSAYTRVHYFLNWIKGELAKQTQ*

IP21814.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:16:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG11841-PA 319 CG11841-PA 1..319 6..324 1706 100 Plus
CG11842-PA 319 CG11842-PA 35..318 39..321 967 61.6 Plus
CG11843-PB 316 CG11843-PB 12..314 21..320 811 51.5 Plus
CG11843-PA 316 CG11843-PA 12..314 21..320 811 51.5 Plus
CG4927-PC 362 CG4927-PC 76..356 47..316 490 38.3 Plus