Clone IP21958 Report

Search the DGRC for IP21958

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:219
Well:58
Vector:pOT2
Associated Gene/TranscriptCG5781-RA
Protein status:IP21958.pep: gold
Sequenced Size:917

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5781 2008-05-05 Release 5.5 slip selected
CG5781 2008-12-18 5.12 accounting

Clone Sequence Records

IP21958.complete Sequence

917 bp assembled on 2008-10-23

GenBank Submission: BT050535.1

> IP21958.complete
TATCGTTTAAGATTAGTCCTTCGCAACTGAAACCGATTTGGTTAGCCAAA
TTATGACCATCACCAACTGGTTTAATTGGTCCGTAAAGGATTTAAGCAAT
GAGTCCCATGCGAGACCCAAGTTGATTCCGGGATTCGACCAGTTGGATAA
GAGGCTGCAGGCGGCGCTTCAGGAGCGGGACGTGCAAAAGCATCAGCGCA
AGCGTACACAGGCGGGTGGTGGCCAAAGCCAGGCAAAGCCCAAAAAGCTC
AAGACGACCAGAAAACAGACACCAAGGGTATGCAAATTCCAGAAGGTTTA
CACTGAGAAACGCAAGAAGCTAAAACGAGAGGCCAACATGCAAAGTAATG
CGTTTCAGTTCCGGAGCAGACCTGTGCCCGATTTCGAGCGATCTCATCGT
CGTTTGGAAAGGCGCAAGCTGTACCTGAACTCTCTGCAAACGGTGACGAA
GCCCCGATGCCCTGCCACGCTGGCCACGTCAATGGTCGCTTTAAACAAGC
GCCTAAAGAAGCAAAGGCAGAGCCGAAAGACATCCGACTTTGTGCCCCGA
ATCAATCCAGGCTCTTCTATGGACTACCTCAACCGGCAGCCCTTTACGCC
GCTTGTCAAGTCCTCCTTTACCCATCCAAAACCTTTTCATCTCCATACGT
CGGAGCGTGCTCTGCGCCGCCAAGTGTATGACGAGAGGAAAAGGATACGG
ATGGATCGGCGTTTGGAGCAGCAGACCATCGATTGGTTTGCACGGGAAAG
AAGCGAGTACTTTAAGCTACGCAAAATGACAAATTTCAAGGCTACGCCGA
ATCCCTGGAAGCAAACAAGGGTCACCGCTAGAAAAGATTCTCAGGCAGCC
TAGAAATGAGATTGTAAATTAAATTTGAAACAAGCTGAATATGGCAGCAA
AAAAAAAAAAAAAAAAA

IP21958.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:11:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG5781-RA 1349 CG5781-RA 452..1349 1..898 4490 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:11:29
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 12695117..12696014 898..1 4490 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:47:13 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:11:27
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12696421..12697323 903..1 4515 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:28:58
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12696421..12697323 903..1 4515 100 Minus
Blast to na_te.dros performed on 2019-03-16 17:11:28 has no hits.

IP21958.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:12:11 Download gff for IP21958.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 12695117..12696014 1..898 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:28:27 Download gff for IP21958.complete
Subject Subject Range Query Range Percent Splice Strand
CG5781-RA 1..801 53..853 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:16:08 Download gff for IP21958.complete
Subject Subject Range Query Range Percent Splice Strand
CG5781-RA 1..801 53..853 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:31:03 Download gff for IP21958.complete
Subject Subject Range Query Range Percent Splice Strand
CG5781-RA 1..801 53..853 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:54:13 Download gff for IP21958.complete
Subject Subject Range Query Range Percent Splice Strand
CG5781-RA 1..801 53..853 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:55:35 Download gff for IP21958.complete
Subject Subject Range Query Range Percent Splice Strand
CG5781-RA 452..1349 1..898 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:16:08 Download gff for IP21958.complete
Subject Subject Range Query Range Percent Splice Strand
CG5781-RA 452..1349 1..898 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:31:03 Download gff for IP21958.complete
Subject Subject Range Query Range Percent Splice Strand
CG5781-RA 1..898 1..898 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-10-23 18:44:10 Download gff for IP21958.complete
Subject Subject Range Query Range Percent Splice Strand
CG5781-RA 452..1349 1..898 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:54:13 Download gff for IP21958.complete
Subject Subject Range Query Range Percent Splice Strand
CG5781-RA 1..898 1..898 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:12:11 Download gff for IP21958.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12696426..12697323 1..898 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:12:11 Download gff for IP21958.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12696426..12697323 1..898 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:12:11 Download gff for IP21958.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12696426..12697323 1..898 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:31:03 Download gff for IP21958.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 12696426..12697323 1..898 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:47:03 Download gff for IP21958.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12696426..12697323 1..898 100   Minus

IP21958.pep Sequence

Translation from 52 to 852

> IP21958.pep
MTITNWFNWSVKDLSNESHARPKLIPGFDQLDKRLQAALQERDVQKHQRK
RTQAGGGQSQAKPKKLKTTRKQTPRVCKFQKVYTEKRKKLKREANMQSNA
FQFRSRPVPDFERSHRRLERRKLYLNSLQTVTKPRCPATLATSMVALNKR
LKKQRQSRKTSDFVPRINPGSSMDYLNRQPFTPLVKSSFTHPKPFHLHTS
ERALRRQVYDERKRIRMDRRLEQQTIDWFARERSEYFKLRKMTNFKATPN
PWKQTRVTARKDSQAA*

IP21958.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 12:10:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15659-PA 258 GF15659-PA 1..256 1..253 594 47.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 12:10:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10244-PA 267 GG10244-PA 1..265 1..266 1023 77.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 12:10:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11664-PA 261 GH11664-PA 29..260 31..259 190 29.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:35:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG5781-PA 266 CG5781-PA 1..266 1..266 1392 100 Plus
mei-38-PC 347 CG14781-PC 195..347 74..253 195 28.2 Plus
CG15395-PB 275 CG15395-PB 84..273 74..255 175 26.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 12:10:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17108-PA 261 GI17108-PA 1..260 1..258 299 34.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 12:10:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19123-PA 269 GA19123-PA 1..263 1..259 401 39.6 Plus
Dpse\GA13699-PA 210 GA13699-PA 41..208 73..255 143 27.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 12:10:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26042-PA 263 GM26042-PA 1..263 1..266 1227 91.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 12:10:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22103-PA 261 GD22103-PA 1..261 1..266 1198 90.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 12:10:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16146-PA 263 GJ16146-PA 1..261 1..257 318 34.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 12:10:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12108-PA 267 GE12108-PA 1..267 1..266 1076 76.8 Plus

IP21958.hyp Sequence

Translation from 52 to 852

> IP21958.hyp
MTITNWFNWSVKDLSNESHARPKLIPGFDQLDKRLQAALQERDVQKHQRK
RTQAGGGQSQAKPKKLKTTRKQTPRVCKFQKVYTEKRKKLKREANMQSNA
FQFRSRPVPDFERSHRRLERRKLYLNSLQTVTKPRCPATLATSMVALNKR
LKKQRQSRKTSDFVPRINPGSSMDYLNRQPFTPLVKSSFTHPKPFHLHTS
ERALRRQVYDERKRIRMDRRLEQQTIDWFARERSEYFKLRKMTNFKATPN
PWKQTRVTARKDSQAA*

IP21958.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:18:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG5781-PA 266 CG5781-PA 1..266 1..266 1392 100 Plus
CG15395-PB 275 CG15395-PB 84..273 74..255 175 26.9 Plus