Clone IP22010 Report

Search the DGRC for IP22010

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:220
Well:10
Vector:pOT2
Associated Gene/TranscriptCG11321-RD
Protein status:IP22010.pep: gold
Sequenced Size:782

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11321 2008-04-29 Release 5.5 accounting
CG11321 2008-05-05 Release 5.5 slip selected
CG11321 2008-08-15 Release 5.9 accounting
CG11321 2008-12-18 5.12 accounting
CG11321 2011-03-01 Transcript Validation

Clone Sequence Records

IP22010.complete Sequence

782 bp assembled on 2007-11-15

GenBank Submission: BT031238

> IP22010.complete
CAGCGTTTAGTTTTGTGCACGGCATCCACGAAACTGCATTTTGGTCATTG
GCTTCGGAATTTGGAAAACCAATCAAGCGCAAAAAGACGATTAAGTGACG
GCAAAACCCAGACGAAAAAATCGACCAAGATGACGACCCACCAGTTGCTA
AACAAGAATGTTCGCACCATGCCCTCCTGGGTGATGGAGGCAAATGACCG
CATTGGGCCCAAACCGCCACCCACGCCACCAAACGGTGTGGCTGGTGGTC
TTCCCAAGGCGCCTGCTCTGCCGCCCAAGGCGAAGAGCACTCCCGAGCCG
GACTACGAGATCATCGAATTCTCCAGCCAGCAGTACTCCAACGAACCGAT
GAAGACCACAGTGATCAGAACCAAGACACCAGATAACAAACTAAAGTGCA
CCTTGTGCGGTTCCCAGAATCCCTGGGTAACCTGTGCCGAGTGCGCCGGC
CAAATCTTTTGCGCCTCCTGCGACGACATGTTCCACAAGCATCCCAAACG
TAAGCAGCACATGAGAAAGGCTGTGGAGCAGGGCACACCGCCGATTCCGC
CAAAGGCACAGGCCGGTGGTGGGGCACCACCACCAGTGGCACCTCCACGA
CGCAGCAAACGAGGCCTTTTGACACCGTTTCTGGGCCGCAAGGATCAGGT
ACGCCACTGCACGATCTCCTAGACCCGTAAGAAAGGCTCCTTCATGGGCT
ACACGTAGTACCAAGTTTGTAAACTTCAATTTGAATGCTTCAATAAAAGA
GTCCTTACAACCAGAAAAAAAAAAAAAAAAAA

IP22010.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:34:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG11321-RD 766 CG11321-RD 1..766 1..766 3830 100 Plus
CG11321-RB 8898 CG11321-RB 1..648 1..648 3240 100 Plus
CG11321-RC 2749 CG11321-RC 1..648 1..648 3240 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:44:24
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 6768896..6769142 764..518 1235 100 Minus
chr2L 23010047 chr2L 6769394..6769593 382..183 1000 100 Minus
chr2L 23010047 chr2L 6769192..6769332 520..380 690 99.3 Minus
chr2L 23010047 chr2L 6769650..6769769 183..64 585 99.2 Minus
chr2L 23010047 chr2L 6769945..6770008 64..1 320 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:47:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:44:22
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6769835..6770083 766..518 1245 100 Minus
2L 23513712 2L 6770335..6770534 382..183 1000 100 Minus
2L 23513712 2L 6770133..6770273 520..380 705 100 Minus
2L 23513712 2L 6770591..6770710 183..64 600 100 Minus
2L 23513712 2L 6770886..6770949 64..1 320 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:30:39
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6769835..6770083 766..518 1245 100 Minus
2L 23513712 2L 6770335..6770534 382..183 1000 100 Minus
2L 23513712 2L 6770133..6770273 520..380 705 100 Minus
2L 23513712 2L 6770591..6770710 183..64 600 100 Minus
2L 23513712 2L 6770886..6770949 64..1 320 100 Minus
Blast to na_te.dros performed on 2019-03-16 16:44:22 has no hits.

IP22010.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:45:17 Download gff for IP22010.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 6769394..6769592 184..382 100 <- Minus
chr2L 6769650..6769768 65..183 99 <- Minus
chr2L 6769945..6770008 1..64 100   Minus
chr2L 6768896..6769140 520..764 100 <- Minus
chr2L 6769193..6769329 383..519 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:28:38 Download gff for IP22010.complete
Subject Subject Range Query Range Percent Splice Strand
CG11321-RB 1..532 130..660 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:03:33 Download gff for IP22010.complete
Subject Subject Range Query Range Percent Splice Strand
CG11321-RD 1..543 130..672 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:43:22 Download gff for IP22010.complete
Subject Subject Range Query Range Percent Splice Strand
CG11321-RD 1..543 130..672 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:48:55 Download gff for IP22010.complete
Subject Subject Range Query Range Percent Splice Strand
CG11321-RB 1..532 130..660 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:39:38 Download gff for IP22010.complete
Subject Subject Range Query Range Percent Splice Strand
CG11321-RD 1..543 130..672 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 16:53:47 Download gff for IP22010.complete
Subject Subject Range Query Range Percent Splice Strand
CG11321-RB 1..532 130..660 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:03:33 Download gff for IP22010.complete
Subject Subject Range Query Range Percent Splice Strand
CG11321-RD 1..764 1..764 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:43:22 Download gff for IP22010.complete
Subject Subject Range Query Range Percent Splice Strand
CG11321-RD 1..764 1..764 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:48:55 Download gff for IP22010.complete
Subject Subject Range Query Range Percent Splice Strand
CG11321-RB 1..532 130..660 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:39:38 Download gff for IP22010.complete
Subject Subject Range Query Range Percent Splice Strand
CG11321-RD 20..783 1..764 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:45:17 Download gff for IP22010.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6769837..6770081 520..764 100 <- Minus
2L 6770134..6770270 383..519 100 <- Minus
2L 6770335..6770533 184..382 100 <- Minus
2L 6770591..6770709 65..183 100 <- Minus
2L 6770886..6770949 1..64 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:45:17 Download gff for IP22010.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6769837..6770081 520..764 100 <- Minus
2L 6770134..6770270 383..519 100 <- Minus
2L 6770335..6770533 184..382 100 <- Minus
2L 6770591..6770709 65..183 100 <- Minus
2L 6770886..6770949 1..64 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:45:17 Download gff for IP22010.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6769837..6770081 520..764 100 <- Minus
2L 6770134..6770270 383..519 100 <- Minus
2L 6770335..6770533 184..382 100 <- Minus
2L 6770591..6770709 65..183 100 <- Minus
2L 6770886..6770949 1..64 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:43:22 Download gff for IP22010.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 6770591..6770709 65..183 100 <- Minus
arm_2L 6770886..6770949 1..64 100   Minus
arm_2L 6769837..6770081 520..764 100 <- Minus
arm_2L 6770134..6770270 383..519 100 <- Minus
arm_2L 6770335..6770533 184..382 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:55:34 Download gff for IP22010.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6769837..6770081 520..764 100 <- Minus
2L 6770134..6770270 383..519 100 <- Minus
2L 6770335..6770533 184..382 100 <- Minus
2L 6770591..6770709 65..183 100 <- Minus
2L 6770886..6770949 1..64 100   Minus

IP22010.hyp Sequence

Translation from 0 to 671

> IP22010.hyp
QRLVLCTASTKLHFGHWLRNLENQSSAKRRLSDGKTQTKKSTKMTTHQLL
NKNVRTMPSWVMEANDRIGPKPPPTPPNGVAGGLPKAPALPPKAKSTPEP
DYEIIEFSSQQYSNEPMKTTVIRTKTPDNKLKCTLCGSQNPWVTCAECAG
QIFCASCDDMFHKHPKRKQHMRKAVEQGTPPIPPKAQAGGGAPPPVAPPR
RSKRGLLTPFLGRKDQVRHCTIS*

IP22010.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:19:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG11321-PK 180 CG11321-PK 1..180 44..223 996 100 Plus
CG11321-PD 180 CG11321-PD 1..180 44..223 996 100 Plus
CG11321-PF 834 CG11321-PF 1..174 44..217 958 99.4 Plus
CG11321-PC 834 CG11321-PC 1..174 44..217 958 99.4 Plus
CG11321-PH 887 CG11321-PH 1..174 44..217 958 99.4 Plus

IP22010.pep Sequence

Translation from 0 to 671

> IP22010.pep
QRLVLCTASTKLHFGHWLRNLENQSSAKRRLSDGKTQTKKSTKMTTHQLL
NKNVRTMPSWVMEANDRIGPKPPPTPPNGVAGGLPKAPALPPKAKSTPEP
DYEIIEFSSQQYSNEPMKTTVIRTKTPDNKLKCTLCGSQNPWVTCAECAG
QIFCASCDDMFHKHPKRKQHMRKAVEQGTPPIPPKAQAGGGAPPPVAPPR
RSKRGLLTPFLGRKDQVRHCTIS*

IP22010.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:31:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14481-PA 2643 GF14481-PA 1..175 44..217 693 93.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:31:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23583-PA 2649 GG23583-PA 1..174 44..217 946 97.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:31:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10789-PA 2931 GH10789-PA 1..172 44..217 714 81.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:09:22
Subject Length Description Subject Range Query Range Score Percent Strand
LUBEL-PK 180 CG11321-PK 1..180 44..223 996 100 Plus
LUBEL-PD 180 CG11321-PD 1..180 44..223 996 100 Plus
LUBEL-PF 834 CG11321-PF 1..174 44..217 958 99.4 Plus
LUBEL-PC 834 CG11321-PC 1..174 44..217 958 99.4 Plus
LUBEL-PH 887 CG11321-PH 1..174 44..217 958 99.4 Plus
LUBEL-PJ 2798 CG11321-PJ 1..174 44..217 958 99.4 Plus
LUBEL-PI 2839 CG11321-PI 1..174 44..217 958 99.4 Plus
LUBEL-PG 2851 CG11321-PG 1..174 44..217 958 99.4 Plus
LUBEL-PE 2892 CG11321-PE 1..174 44..217 958 99.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:31:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17301-PA 2530 GI17301-PA 1..177 44..217 712 82.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:31:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25962-PA 911 GL25962-PA 1..136 44..174 616 89.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:31:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10917-PA 2919 GA10917-PA 1..181 44..217 793 87.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:31:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13847-PA 2538 GM13847-PA 1..174 44..217 954 98.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:31:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22542-PA 2003 GD22542-PA 1..174 44..217 953 98.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:31:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15691-PA 2272 GJ15691-PA 1..176 44..217 798 85.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:31:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24212-PA 2698 GK24212-PA 1..177 44..217 763 83.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:31:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18404-PA 2402 GE18404-PA 1..174 44..217 796 96 Plus