Clone KHBD00414 Report

Search the DGRC for KHBD00414

Clone and Library Details

Library:KHBD
Tissue Source:
Created by:
Date Registered:2011-09-07
Comments:
Original Plate Number:10
Well:3
Vector:pDONR221
Associated Gene/TranscriptCG7045-RA
Protein status:KHBD00414.pep: Inserted from web
Sequenced Size:Not sequenced

Clone Sequence Records

KHBD00414.complete Sequence

378 bp (378 high quality bases) assembled on 2011-07-12

> KHBD00414.complete
ATGTCAGACTGCGGAGCGCGCCCCAAAAAACCCATGAGCGCCTTCATGTT
GTGGATGAATTCCACCGGGCGGAAGCACATAAAAGCGGAGCATCCCGATT
TTAGTGTCCAAGAAGTGTCTGTGAAGGGCGGAGAGATGTGGCGAGCCATG
GCCGATGAGGACAAGATCGTGTGGCAGGAGTCGGCCACCACGGCAATGGC
CGAGTACAAGGAGAAGTTGAAGCAGTGGAATTTCCCCAAGGAGCACCGCT
TTTCGGACACGCAATGTATTTGTTCCTCAAATACTAACCAATGCCCCACC
CTTTTTGTGTACGACACCATGGATGACTCGATGACTCCGATCTGCAGGAA
GTGCTTATCAAAGACCAGGTGCCTTCAC

KHBD00414.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:04:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 18315491..18315868 1..378 1875 99.7 Plus
chr3R 27901430 chr3R 18316828..18317074 1..247 1010 93.9 Plus
chr3R 27901430 chr3R 18317124..18317226 276..378 290 85.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:04:53
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 22491927..22492304 1..378 1890 100 Plus
3R 32079331 3R 22493263..22493509 1..247 1010 93.9 Plus
3R 32079331 3R 22493559..22493661 276..378 290 85.4 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:02:25
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 22232758..22233135 1..378 1890 100 Plus
3R 31820162 3R 22234094..22234340 1..247 1010 93.9 Plus
3R 31820162 3R 22234390..22234492 276..378 290 85.4 Plus
Blast to na_te.dros performed on 2019-03-15 11:04:53 has no hits.

KHBD00414.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:06:06 Download gff for KHBD00414.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 18315491..18315868 1..378 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-09-21 15:20:07 Download gff for KHBD00414.complete
Subject Subject Range Query Range Percent Splice Strand
CG7045-RA 1..378 1..378 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:34:36 Download gff for KHBD00414.complete
Subject Subject Range Query Range Percent Splice Strand
CG7045-RA 1..378 1..378 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:20:51 Download gff for KHBD00414.complete
Subject Subject Range Query Range Percent Splice Strand
CG7045-RA 1..378 1..378 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-21 15:20:07 Download gff for KHBD00414.complete
Subject Subject Range Query Range Percent Splice Strand
CG7045-RA 99..476 1..378 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:34:36 Download gff for KHBD00414.complete
Subject Subject Range Query Range Percent Splice Strand
CG7045-RA 99..476 1..378 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:20:51 Download gff for KHBD00414.complete
Subject Subject Range Query Range Percent Splice Strand
CG7045-RA 99..476 1..378 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:06:06 Download gff for KHBD00414.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22491927..22492304 1..378 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:06:06 Download gff for KHBD00414.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22491927..22492304 1..378 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:06:06 Download gff for KHBD00414.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22491927..22492304 1..378 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:34:36 Download gff for KHBD00414.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 18317649..18318026 1..378 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:29:35 Download gff for KHBD00414.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22232758..22233135 1..378 100   Plus

KHBD00414.pep Sequence

Translation from 0 to 378

> KHBD00414.pep
MSDCGARPKKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAM
ADEDKIVWQESATTAMAEYKEKLKQWNFPKEHRFSDTQCICSSNTNQCPT
LFVYDTMDDSMTPICRKCLSKTRCLH

KHBD00414.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 23:08:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18856-PA 209 GF18856-PA 1..76 1..76 213 47.4 Plus
Dana\GF13265-PA 111 GF13265-PA 4..69 7..75 161 47.8 Plus
Dana\GF12460-PA 728 GF12460-PA 554..620 7..76 157 41.4 Plus
Dana\GF11622-PA 111 GF11622-PA 2..71 4..76 152 37 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 23:08:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11142-PA 138 GG11142-PA 1..138 1..126 442 61.4 Plus
Dere\GG22136-PA 111 GG22136-PA 1..69 1..75 164 46.7 Plus
Dere\GG20749-PA 111 GG20749-PA 2..71 4..76 162 39.7 Plus
Dere\GG19998-PA 724 GG19998-PA 551..618 6..76 144 36.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 23:08:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21124-PA 111 GH21124-PA 4..68 7..74 161 47.1 Plus
Dgri\GH20784-PA 111 GH20784-PA 2..71 4..76 160 39.7 Plus
Dgri\GH21151-PA 744 GH21151-PA 559..625 7..76 159 40 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:19:31
Subject Length Description Subject Range Query Range Score Percent Strand
tHMG1-PA 126 CG7045-PA 1..126 1..126 698 100 Plus
tHMG2-PA 133 CG7046-PA 1..133 1..126 491 71.4 Plus
tHMG2-PB 134 CG7046-PB 2..134 1..126 491 71.4 Plus
HmgD-PD 112 CG17950-PD 1..70 1..76 166 46.1 Plus
HmgD-PC 112 CG17950-PC 1..70 1..76 166 46.1 Plus
HmgD-PB 112 CG17950-PB 1..70 1..76 166 46.1 Plus
HmgD-PA 112 CG17950-PA 1..70 1..76 166 46.1 Plus
HmgZ-PD 111 CG17921-PD 3..71 5..76 163 40.3 Plus
HmgZ-PC 111 CG17921-PC 3..71 5..76 163 40.3 Plus
HmgZ-PA 111 CG17921-PA 3..71 5..76 163 40.3 Plus
HmgZ-PB 111 CG17921-PB 3..71 5..76 163 40.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 23:08:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18728-PA 112 GI18728-PA 4..68 7..74 158 47.1 Plus
Dmoj\GI20867-PA 111 GI20867-PA 2..71 4..76 158 38.4 Plus
Dmoj\GI18750-PA 734 GI18750-PA 560..626 7..76 149 38.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 23:08:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23184-PA 82 GL23184-PA 3..73 6..76 182 43.7 Plus
Dper\GL17523-PA 113 GL17523-PA 1..73 1..76 171 42.1 Plus
Dper\GL11071-PA 727 GL11071-PA 556..621 8..76 160 43.5 Plus
Dper\GL16947-PA 111 GL16947-PA 4..68 7..74 156 47.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 23:08:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20056-PA 115 GA20056-PA 8..75 9..76 184 41.2 Plus
Dpse\GA27181-PA 82 GA27181-PA 3..73 6..76 182 43.7 Plus
Dpse\GA14726-PA 113 GA14726-PA 1..73 1..76 171 42.1 Plus
Dpse\GA30453-PC 111 GA30453-PC 4..68 7..74 156 47.1 Plus
Dpse\GA30453-PB 111 GA30453-PB 4..68 7..74 156 47.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 23:08:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26441-PA 137 GM26441-PA 1..137 1..126 447 61.2 Plus
Dsec\GM15692-PA 111 GM15692-PA 2..71 4..76 162 39.7 Plus
Dsec\GM15859-PA 112 GM15859-PA 1..69 1..75 161 46.7 Plus
Dsec\GM13209-PA 111 GM13209-PA 4..69 7..75 146 43.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 23:08:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20959-PA 137 GD20959-PA 1..137 1..126 439 60.6 Plus
Dsim\GD11309-PA 91 GD11309-PA 2..91 19..126 253 47.2 Plus
Dsim\GD15641-PA 65 GD15641-PA 1..56 17..72 198 66.1 Plus
Dsim\GD24602-PA 65 GD24602-PA 1..56 17..72 198 66.1 Plus
Dsim\GD25171-PA 111 GD25171-PA 2..71 4..76 162 39.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 23:08:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21748-PA 112 GJ21748-PA 4..68 7..74 161 47.1 Plus
Dvir\GJ20604-PA 111 GJ20604-PA 2..71 4..76 157 38.4 Plus
Dvir\GJ21774-PA 729 GJ21774-PA 558..624 7..76 147 38.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 23:08:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15924-PA 111 GK15924-PA 4..69 7..75 162 46.4 Plus
Dwil\GK15658-PA 112 GK15658-PA 2..71 4..76 159 38.4 Plus
Dwil\GK22092-PA 730 GK22092-PA 555..620 8..76 147 39.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 23:08:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10308-PA 138 GE10308-PA 1..138 1..126 431 58.6 Plus
Dyak\HmgD-PA 111 GE12217-PA 1..69 1..75 164 46.7 Plus
Dyak\HmgZ-PA 111 GE13680-PA 2..71 4..76 162 39.7 Plus
Dyak\GE11532-PA 726 GE11532-PA 553..620 6..76 144 36.6 Plus

KHBD00414.hyp Sequence

Translation from 1 to 378

> KHBD00414.hyp
MSDCGARPKKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAM
ADEDKIVWQESATTAMAEYKEKLKQWNFPKEHRFSDTQCICSSNTNQCPT
LFVYDTMDDSMTPICRKCLSKTRCLH

KHBD00414.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:31:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG7045-PA 126 CG7045-PA 1..126 1..126 698 100 Plus
CG7046-PA 133 CG7046-PA 1..133 1..126 491 71.4 Plus
CG7046-PB 134 CG7046-PB 2..134 1..126 491 71.4 Plus
HmgD-PD 112 CG17950-PD 1..70 1..76 166 46.1 Plus
HmgD-PC 112 CG17950-PC 1..70 1..76 166 46.1 Plus