Clone KHBD00515 Report

Search the DGRC for KHBD00515

Clone and Library Details

Library:KHBD
Tissue Source:
Created by:
Date Registered:2011-09-07
Comments:
Original Plate Number:10
Well:7
Vector:pDONR221
Associated Gene/TranscriptCG8119-RA
Protein status:KHBD00515.pep: Inserted from web
Sequenced Size:Not sequenced

Clone Sequence Records

KHBD00515.complete Sequence

732 bp (732 high quality bases) assembled on 2011-07-12

> KHBD00515.complete
ATGACTTCTGCCGATAACAAGTATCCGACCAACAATCTGGAGACAAACCA
CCTACTCCGCGAGATTGCACTTCGTCCATCGATCTGGGACAGTCGCATCA
AATTCTCGCTGCGTCGGCCGCAAATCCCTATCGACTGGCTGGATGTCTCC
AATGCGGTAGGACTTGGCGTTGACGAGTGCAAGCGGCGTTGGAAGAGTCT
GCGTAACAACTACCGCACTAAGATCCACCAAGGAAACGCCTGGAGCTGGC
CGCACTCCAAACAAATGGAGTTCGTTCGCGATGTCTTCCCGCCACACAAG
CCCAAGACTCCTGCGCGTTGCCGTGTTCAGGTGAAGAAAAGCAAGCTAAT
TCTACATCCGCAACAATATCTGCAATCGGTGGCGAGCTATTCGGCATTCA
AAAAGGGTGGCATCGAATTCGAGGCGGAGGAGAGACTCTTTCTGGTTACG
GACGAGCCGGCATTCGATCTGGATGTGGACGAGGAGGTGACCAGGCTATT
GGGCACCGATCAATGGTTGTGGCAAACCAATCTGGACTTCATACTACTGC
CCATTTTTCGAGCGCCACCGCCATCAGCCATGGCCAAAATATCCAACGAA
TCGAACCGCCATTTCCTGCTCAGCATGGTGCCCATGCTCCGATCTTTGAG
CGATCGCAGCAAGGAACGTTTCCGCAGTTGGACACGGCGAGTGCTAAGGG
AGATGCTCATCGCGGAGAAGAAGCTGCTGACG

KHBD00515.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:05:06
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 15552426..15553157 1..732 3630 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:05:04
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15662585..15663316 1..732 3645 99.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:02:43
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 15670683..15671414 1..732 3645 99.8 Plus
Blast to na_te.dros performed on 2019-03-15 11:05:05 has no hits.

KHBD00515.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:06:13 Download gff for KHBD00515.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 15552426..15553157 1..732 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-09-21 15:20:10 Download gff for KHBD00515.complete
Subject Subject Range Query Range Percent Splice Strand
CG8119-RA 1..732 1..732 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:34:48 Download gff for KHBD00515.complete
Subject Subject Range Query Range Percent Splice Strand
CG8119-RA 1..732 1..732 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:21:02 Download gff for KHBD00515.complete
Subject Subject Range Query Range Percent Splice Strand
CG8119-RA 1..732 1..732 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-21 15:20:09 Download gff for KHBD00515.complete
Subject Subject Range Query Range Percent Splice Strand
CG8119-RA 1..732 1..732 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:34:48 Download gff for KHBD00515.complete
Subject Subject Range Query Range Percent Splice Strand
CG8119-RA 1..732 1..732 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:21:02 Download gff for KHBD00515.complete
Subject Subject Range Query Range Percent Splice Strand
CG8119-RA 1..732 1..732 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:06:13 Download gff for KHBD00515.complete
Subject Subject Range Query Range Percent Splice Strand
X 15662585..15663316 1..732 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:06:13 Download gff for KHBD00515.complete
Subject Subject Range Query Range Percent Splice Strand
X 15662585..15663316 1..732 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:06:13 Download gff for KHBD00515.complete
Subject Subject Range Query Range Percent Splice Strand
X 15662585..15663316 1..732 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:34:48 Download gff for KHBD00515.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 15556618..15557349 1..732 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:29:41 Download gff for KHBD00515.complete
Subject Subject Range Query Range Percent Splice Strand
X 15670683..15671414 1..732 99   Plus

KHBD00515.pep Sequence

Translation from 0 to 732

> KHBD00515.pep
MTSADNKYPTNNLETNHLLREIALRPSIWDSRIKFSLRRPQIPIDWLDVS
NAVGLGVDECKRRWKSLRNNYRTKIHQGNAWSWPHSKQMEFVRDVFPPHK
PKTPARCRVQVKKSKLILHPQQYLQSVASYSAFKKGGIEFEAEERLFLVT
DEPAFDLDVDEEVTRLLGTDQWLWQTNLDFILLPIFRAPPPSAMAKISNE
SNRHFLLSMVPMLRSLSDRSKERFRSWTRRVLREMLIAEKKLLT

KHBD00515.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 23:09:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19458-PA 357 GF19458-PA 25..133 13..118 178 36.4 Plus
Dana\GF15306-PA 378 GF15306-PA 8..95 18..100 158 37.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 23:09:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17894-PA 389 GG17894-PA 150..389 12..244 686 58.5 Plus
Dere\GG17894-PA 389 GG17894-PA 1..138 1..135 332 49.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:49:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG8119-PA 244 CG8119-PA 1..244 1..244 1289 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 23:09:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16972-PA 340 GI16972-PA 3..95 13..100 162 36.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 23:09:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22159-PA 282 GL22159-PA 1..233 13..235 187 25.8 Plus
Dper\GL19421-PA 350 GL19421-PA 8..93 18..98 150 37.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 23:09:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28255-PA 282 GA28255-PA 1..233 13..235 177 24.6 Plus
Dpse\GA11162-PA 349 GA11162-PA 8..93 18..98 150 37.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 23:09:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22560-PA 294 GM22560-PA 1..243 1..242 923 75 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 23:09:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17225-PA 254 GD17225-PA 1..243 1..242 930 76.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 23:09:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17218-PA 343 GJ17218-PA 3..95 13..100 160 32.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 23:09:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17202-PA 245 GE17202-PA 2..245 10..244 694 58.9 Plus

KHBD00515.hyp Sequence

Translation from 1 to 732

> KHBD00515.hyp
MTSADNKYPTNNLETNHLLREIALRPSIWDSRIKFSLRRPQIPIDWLDVS
NAVGLGVDECKRRWKSLRNNYRTKIHQGNAWSWPHSKQMEFVRDVFPPHK
PKTPARCRVQVKKSKLILHPQQYLQSVASYSAFKKGGIEFEAEERLFLVT
DEPAFDLDVDEEVTRLLGTDQWLWQTNLDFILLPIFRAPPPSAMAKISNE
SNRHFLLSMVPMLRSLSDRSKERFRSWTRRVLREMLIAEKKLLT

KHBD00515.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:31:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG8119-PA 244 CG8119-PA 1..244 1..244 1289 100 Plus