Clone KHBD00529 Report

Search the DGRC for KHBD00529

Clone and Library Details

Library:KHBD
Tissue Source:
Created by:
Date Registered:2011-09-07
Comments:
Original Plate Number:10
Well:11
Vector:pDONR221
Associated Gene/TranscriptCG33557-RA
Protein status:KHBD00529.pep: Inserted from web
Sequenced Size:Not sequenced

Clone Sequence Records

KHBD00529.complete Sequence

450 bp (450 high quality bases) assembled on 2011-07-12

> KHBD00529.complete
ATGGCGGTCTCATCGTCCTCGTCGTCGTTTTCCAACTACTTGATGGCGGT
ATTTGCCCAGGATAGCAATAGTAGTGGCAGTGCCAGCGGAAGTGGAGCAG
CCGCCGACTCGGAGGACTCCCAGATTGGCCAGGAGGCCAATCCAGGTGGC
CAGGAGAATCAGGGAAATCACAGGAGGCGACCGCCGCGCCAGAAGATCAA
TGCTAGAGAGCGCTATCGGACATTTAATGTTAATTCGGCCTACGAGGCAT
TAAGAAATTTAATACCCACGGAGCCCATGAATCGCAAGCTTTCAAAGATC
GAGATCATCCGCCTGGCCAGCAGCTATATAACGCACCTAAGTAGCACCCT
AGAAACAGGCACTGAATGCCAGCCATGTTTGCTGCACAAATACGAGAGCG
AAGGAATAACTAGACGTATCAGTATCTGCACCTTTTGCCTGAAAACCAAA

KHBD00529.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:05:20
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 9900875..9901101 1..227 1135 100 Plus
chrX 22417052 chrX 9901211..9901342 228..359 660 100 Plus
chrX 22417052 chrX 9901397..9901487 357..447 455 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:05:18
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 10009235..10009461 1..227 1135 100 Plus
X 23542271 X 10009571..10009702 228..359 660 100 Plus
X 23542271 X 10009757..10009850 357..450 470 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:02:01
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 10017333..10017559 1..227 1135 100 Plus
X 23527363 X 10017669..10017800 228..359 660 100 Plus
X 23527363 X 10017855..10017948 357..450 470 100 Plus
Blast to na_te.dros performed on 2019-03-15 11:05:18 has no hits.

KHBD00529.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:06:19 Download gff for KHBD00529.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 9900875..9901101 1..227 100 -> Plus
chrX 9901211..9901341 228..358 100 -> Plus
chrX 9901399..9901487 359..447 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-09-21 15:20:12 Download gff for KHBD00529.complete
Subject Subject Range Query Range Percent Splice Strand
CG33557-RA 1..450 1..450 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:34:59 Download gff for KHBD00529.complete
Subject Subject Range Query Range Percent Splice Strand
CG33557-RA 1..450 1..450 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:21:15 Download gff for KHBD00529.complete
Subject Subject Range Query Range Percent Splice Strand
CG33557-RA 1..450 1..450 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-21 15:20:12 Download gff for KHBD00529.complete
Subject Subject Range Query Range Percent Splice Strand
CG33557-RA 1..447 1..447 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:34:59 Download gff for KHBD00529.complete
Subject Subject Range Query Range Percent Splice Strand
CG33557-RA 26..472 1..447 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:21:15 Download gff for KHBD00529.complete
Subject Subject Range Query Range Percent Splice Strand
CG33557-RA 26..472 1..447 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:06:19 Download gff for KHBD00529.complete
Subject Subject Range Query Range Percent Splice Strand
X 10009235..10009461 1..227 100 -> Plus
X 10009571..10009701 228..358 100 -> Plus
X 10009759..10009847 359..447 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:06:19 Download gff for KHBD00529.complete
Subject Subject Range Query Range Percent Splice Strand
X 10009235..10009461 1..227 100 -> Plus
X 10009571..10009701 228..358 100 -> Plus
X 10009759..10009847 359..447 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:06:19 Download gff for KHBD00529.complete
Subject Subject Range Query Range Percent Splice Strand
X 10009235..10009461 1..227 100 -> Plus
X 10009571..10009701 228..358 100 -> Plus
X 10009759..10009847 359..447 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:34:59 Download gff for KHBD00529.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 9903268..9903494 1..227 100 -> Plus
arm_X 9903604..9903734 228..358 100 -> Plus
arm_X 9903792..9903880 359..447 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:28:57 Download gff for KHBD00529.complete
Subject Subject Range Query Range Percent Splice Strand
X 10017333..10017559 1..227 100 -> Plus
X 10017669..10017799 228..358 100 -> Plus
X 10017857..10017945 359..447 100   Plus

KHBD00529.pep Sequence

Translation from 0 to 450

> KHBD00529.pep
MAVSSSSSSFSNYLMAVFAQDSNSSGSASGSGAAADSEDSQIGQEANPGG
QENQGNHRRRPPRQKINARERYRTFNVNSAYEALRNLIPTEPMNRKLSKI
EIIRLASSYITHLSSTLETGTECQPCLLHKYESEGITRRISICTFCLKTK

KHBD00529.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 23:04:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16489-PA 148 GF16489-PA 2..148 6..150 442 65.5 Plus
Dana\GF17655-PA 251 GF17655-PA 83..157 63..134 142 42.7 Plus
Dana\GF11275-PA 200 GF11275-PA 87..173 35..120 136 37.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 23:04:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18335-PA 152 GG18335-PA 1..152 1..150 663 93.4 Plus
Dere\GG13863-PA 251 GG13863-PA 83..157 63..134 143 42.7 Plus
Dere\GG22282-PA 189 GG22282-PA 101..162 57..120 134 43.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 23:04:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11812-PA 157 GH11812-PA 32..149 35..150 373 61.7 Plus
Dgri\GH19006-PA 262 GH19006-PA 83..157 63..134 146 42.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:21:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG33557-PA 150 CG33557-PA 1..150 1..150 765 100 Plus
Fer1-PA 251 CG33323-PA 23..157 2..134 153 30.9 Plus
Fer1-PB 256 CG33323-PB 23..162 2..134 148 31 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 23:04:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15998-PA 176 GI15998-PA 29..167 4..150 410 59.7 Plus
Dmoj\GI23061-PA 278 GI23061-PA 83..157 63..134 144 42.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 23:04:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16388-PA 119 GL16388-PA 1..82 1..92 151 49 Plus
Dper\GL12422-PA 253 GL12422-PA 83..157 63..134 143 42.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 23:04:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22362-PA 147 GA22362-PA 56..147 64..150 397 82.6 Plus
Dpse\GA27498-PA 253 GA27498-PA 83..157 63..134 143 42.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 23:04:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11398-PA 150 GM11398-PA 1..150 1..150 778 98 Plus
Dsec\GM10936-PA 247 GM10936-PA 83..157 63..134 141 42.7 Plus
Dsec\GM20070-PA 188 GM20070-PA 100..161 57..120 140 45.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 23:04:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16966-PA 150 GD16966-PA 1..150 1..150 784 98.7 Plus
Dsim\GD19915-PA 251 GD19915-PA 83..157 63..134 143 42.7 Plus
Dsim\GD25551-PA 188 GD25551-PA 100..161 57..120 135 43.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 23:04:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18724-PA 168 GJ18724-PA 21..157 10..148 366 53.6 Plus
Dvir\GJ24574-PA 261 GJ24574-PA 83..157 63..134 146 42.7 Plus
Dvir\GJ19415-PA 390 GJ19415-PA 180..231 67..118 140 53.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 23:04:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25368-PA 125 GK25368-PA 1..114 1..118 352 64.4 Plus
Dwil\GK14521-PA 247 GK14521-PA 84..158 63..134 140 42.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 23:04:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17822-PA 151 GE17822-PA 1..151 1..150 766 97.4 Plus
Dyak\GE24907-PA 251 GE24907-PA 83..157 63..134 142 42.7 Plus

KHBD00529.hyp Sequence

Translation from 1 to 447

> KHBD00529.hyp
MAVSSSSSSFSNYLMAVFAQDSNSSGSASGSGAAADSEDSQIGQEANPGG
QENQGNHRRRPPRQKINARERYRTFNVNSAYEALRNLIPTEPMNRKLSKI
EIIRLASSYITHLSSTLETGTECQPCLLHKYESEGITRRISICTFCLKT

KHBD00529.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:27:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG33557-PA 150 CG33557-PA 1..149 1..149 760 100 Plus
Fer1-PA 251 CG33323-PA 23..157 2..134 153 30.9 Plus
Fer1-PB 256 CG33323-PB 23..162 2..134 148 31 Plus