Clone LD01519 Report

Search the DGRC for LD01519

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:15
Well:19
Vector:pBS SK-
Associated Gene/TranscriptCG11007-RA
Protein status:LD01519.pep: gold
Preliminary Size:1377
Sequenced Size:1223

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11007 2001-01-01 Release 2 assignment
CG11007 2002-05-31 Blastp of sequenced clone
CG11007 2003-01-01 Sim4 clustering to Release 3
CG11007 2008-04-29 Release 5.5 accounting
CG11007 2008-08-15 Release 5.9 accounting
CG11007 2008-12-18 5.12 accounting

Clone Sequence Records

LD01519.complete Sequence

1223 bp (1223 high quality bases) assembled on 2002-05-31

GenBank Submission: AY118488

> LD01519.complete
CTAAAATTAACAATTGGCTGTCAAAAGCAAGAAAAGAAAAACTCGGGAAA
TTGTTAATTAAAATCGTGACCCAGATCAGCGCATTCAGCCCCCGGACGCA
GAGATGACGTGGAAGAAGCAGATGGCTCTGCTGGCCAAGCCATACTACTG
GGTTAACATACTCCTGGCCATATCGTACCTTTTGGCCAAAAAGACGCAGT
TCATCTGCACCCGCCTATTTATTCTCGCCGGAGAGGATGAAGCATGCGAC
CTGGACAGTCGTGAGGTGGAAATCTTGTTCTTCCTGCTAATCGTGGTGAT
GATACGGTCACGCAAAACGGGCAGTGTCACCATGATTAACTACTTGGCCT
CGTCGTTCCTCTACACCAAAGTGGCCAACGCCATTTTGTGGGCCTACGCG
GACTTCCGCTACGGCCTGGGCTTTCTGCTTCTATGCGTCCTGGTGGGCAT
GGTGCTGCCGGAGCCCTCGTATCGCGGACCCGAGCACATCACCTACTTCC
GCAACGCACAGGTCTTCGAGGAGGAATTGGCCAGGGACAAGCGAACCAGC
TGGCTGATCTGCTTCTACACGGTGTGGAATCCCAGCTGCGTGAACTTCGC
CCCCGTTTTTGCTGAGCTCTCCGCCGAGTACAACACGGACCACCTGAAGT
TCGGCAAGATTGACATTGGACGCTTTCCGGACGTGGCCCAAAAGTATCGC
ATCTCGGACAGCAGCTTCTCCCGACAGCTACCAACTGTGATCCTGTTCCA
ACAGGGCAAGGAGACGGACCGCAGGCCCTGCGTCGATTCCAAGGGTAAAC
TGCAAAAGTTCTTCTTCTCCAGCGACAATGTGCGCGCCACCTTTGGCCTT
AACCAGCTGTACAAGGAGGCCATCGAACGACTACCCATTGCGCCCAAGGA
GGCCAAGAAGGTCCAGTAGGCTGTCCTGTCCACCACTGGTGCCATCTCAT
TTCTGCGTGCACGTGCTAATAACTGTTATTCGTTTAGTTCATAGTTTATT
TTAACTTATTGAGGAGCTGCCACCGCCAAAGACACGTACAATTGCACTAA
TATTTGCATTCTAAACTCAGACGTGCTCTCGTCGCGATGCCATTGTAGAA
AATATTTGTATGATCTTGCATTTGCATAAATTGTAGCTAATCACCAGGTA
CCAAATATATTTAAAAATGTGAAATGAGTCAACGAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAA

LD01519.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:56:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG11007-RA 1190 CG11007-RA 7..1190 1..1184 5920 100 Plus
CG11007.a 1129 CG11007.a 7..700 1..694 3470 100 Plus
CG11007.a 1129 CG11007.a 700..1129 755..1184 2150 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:30:04
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 15390271..15391454 1..1184 5680 98.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:48:10 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:30:02
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19503085..19504272 1..1188 5940 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:28:23
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 19504284..19505471 1..1188 5940 100 Plus
Blast to na_te.dros performed 2019-03-15 21:30:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dtak\R1A2 1753 Dtak\R1A2 TAKR1A2 1753bp 732..773 99..140 120 76.2 Plus

LD01519.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:30:47 Download gff for LD01519.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 15390271..15391454 1..1184 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:29:48 Download gff for LD01519.complete
Subject Subject Range Query Range Percent Splice Strand
CG11007-RA 1..816 104..919 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:34:25 Download gff for LD01519.complete
Subject Subject Range Query Range Percent Splice Strand
CG11007-RA 1..816 104..919 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:50:29 Download gff for LD01519.complete
Subject Subject Range Query Range Percent Splice Strand
CG11007-RA 1..816 104..919 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:25:59 Download gff for LD01519.complete
Subject Subject Range Query Range Percent Splice Strand
CG11007-RA 1..816 104..919 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:55:43 Download gff for LD01519.complete
Subject Subject Range Query Range Percent Splice Strand
CG11007-RA 1..816 104..919 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:05:36 Download gff for LD01519.complete
Subject Subject Range Query Range Percent Splice Strand
CG11007-RA 7..1190 1..1184 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:34:25 Download gff for LD01519.complete
Subject Subject Range Query Range Percent Splice Strand
CG11007-RA 7..1190 1..1184 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:50:29 Download gff for LD01519.complete
Subject Subject Range Query Range Percent Splice Strand
CG11007-RA 18..1201 1..1184 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:26:00 Download gff for LD01519.complete
Subject Subject Range Query Range Percent Splice Strand
CG11007-RA 7..1190 1..1184 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:55:43 Download gff for LD01519.complete
Subject Subject Range Query Range Percent Splice Strand
CG11007-RA 18..1201 1..1184 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:30:47 Download gff for LD01519.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19503085..19504268 1..1184 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:30:47 Download gff for LD01519.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19503085..19504268 1..1184 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:30:47 Download gff for LD01519.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19503085..19504268 1..1184 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:50:29 Download gff for LD01519.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15390590..15391773 1..1184 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:58:26 Download gff for LD01519.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19504284..19505467 1..1184 100   Plus

LD01519.hyp Sequence

Translation from 103 to 918

> LD01519.hyp
MTWKKQMALLAKPYYWVNILLAISYLLAKKTQFICTRLFILAGEDEACDL
DSREVEILFFLLIVVMIRSRKTGSVTMINYLASSFLYTKVANAILWAYAD
FRYGLGFLLLCVLVGMVLPEPSYRGPEHITYFRNAQVFEEELARDKRTSW
LICFYTVWNPSCVNFAPVFAELSAEYNTDHLKFGKIDIGRFPDVAQKYRI
SDSSFSRQLPTVILFQQGKETDRRPCVDSKGKLQKFFFSSDNVRATFGLN
QLYKEAIERLPIAPKEAKKVQ*

LD01519.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:23:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG11007-PB 271 CG11007-PB 1..271 1..271 1411 100 Plus
CG11007-PA 271 CG11007-PA 1..271 1..271 1411 100 Plus

LD01519.pep Sequence

Translation from 103 to 918

> LD01519.pep
MTWKKQMALLAKPYYWVNILLAISYLLAKKTQFICTRLFILAGEDEACDL
DSREVEILFFLLIVVMIRSRKTGSVTMINYLASSFLYTKVANAILWAYAD
FRYGLGFLLLCVLVGMVLPEPSYRGPEHITYFRNAQVFEEELARDKRTSW
LICFYTVWNPSCVNFAPVFAELSAEYNTDHLKFGKIDIGRFPDVAQKYRI
SDSSFSRQLPTVILFQQGKETDRRPCVDSKGKLQKFFFSSDNVRATFGLN
QLYKEAIERLPIAPKEAKKVQ*

LD01519.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:39:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11720-PA 271 GF11720-PA 1..271 1..271 1360 91.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:39:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21982-PA 271 GG21982-PA 1..271 1..271 1429 97.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:39:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23004-PA 274 GH23004-PA 1..274 1..271 1252 83.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:04:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG11007-PB 271 CG11007-PB 1..271 1..271 1411 100 Plus
CG11007-PA 271 CG11007-PA 1..271 1..271 1411 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:39:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18970-PA 270 GI18970-PA 1..268 1..269 1205 81.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:39:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21292-PA 277 GL21292-PA 1..277 1..271 1279 84.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:39:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10704-PA 277 GA10704-PA 1..277 1..271 1279 84.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:39:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21970-PA 271 GM21970-PA 1..271 1..271 1440 99.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:39:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11463-PA 257 GD11463-PA 1..257 1..271 1354 94.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:39:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20914-PA 273 GJ20914-PA 1..271 1..269 1257 86 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:39:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15878-PA 275 GK15878-PA 1..273 1..269 1269 84.6 Plus
Dwil\GK23481-PA 261 GK23481-PA 1..261 1..271 1169 78.9 Plus
Dwil\GK22147-PA 122 GK22147-PA 1..120 1..132 503 72.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:39:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12061-PA 271 GE12061-PA 1..271 1..271 1434 98.5 Plus