Clone LD01705 Report

Search the DGRC for LD01705

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:17
Well:5
Vector:pBS SK-
Associated Gene/TranscripteEF1delta-RB
Protein status:LD01705.pep: gold
Preliminary Size:1088
Sequenced Size:921

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4912 2001-01-01 Release 2 assignment
CG4912 2003-01-01 Sim4 clustering to Release 3
CG4912 2003-01-13 Blastp of sequenced clone
eEF1delta 2008-04-29 Release 5.5 accounting
eEF1delta 2008-08-15 Release 5.9 accounting
eEF1delta 2008-12-18 5.12 accounting

Clone Sequence Records

LD01705.complete Sequence

921 bp (921 high quality bases) assembled on 2003-01-13

GenBank Submission: BT003281

> LD01705.complete
AACGTGTTTGAGTAAATCTGCGGGCGAAAGACTAAAAATGAAAGTAGAGG
CATTGGACAAATTCTGGGCTGACAAGAGCCGCTACGATCTTGCCGAGAAG
CGATTCTACGAGGGTCCCCAGAAGGTAACTGATCGCAGCCACTACAGCCC
ATTAGTAAGCGAAATCGCAAAGGCTAGGGAACACATACAGAACTCGCTGG
AAAAGATCGATGGCGTTACTCTGGACGATGGCTTAAATTCCGAGCTGGCC
AAGCGTCTGGCCCAATTGGAGGGTGAACACAAGGAGTTGAAGACCCAGGT
TTCCTTGTTGAACGAACTTTTGACTGCCACAGTGAAGCGCTTGGAAACTC
AGCTGAAATTGACGAATGGAGTGTCGAAAGAGCCCGAGGTCGAAGCGAAA
AAACCAGAAGCGAACGACGACGATGACGATGTGGATCTATTTGGATCGGA
CAGCGAGGAGGAGGATGGAGAGGCCGCCCGCATAAGGGAGGAAAGGCTGG
CAGCCTATGCTGCCAAGAAGGCCAAGAAAGTTCAAATTATTGCCAAGTCG
AACATCATTCTGGATGTTAAGCCGTGGGACGATGAGACCGATCTGAAGGT
TATGGAGACGGAAATCCGCAAAATCACCCAGGACGGTCTACTGTGGGGAG
CTTCCAAATTCGTGCCAGTTGCCTTTGGCATTCAGAAACTGAGCATTTCA
TGCGTGGTTGAGGATGATAAGGTTTCCATCGATTGGCTGACTGAGGAGAT
CGAGAAACTGGAAGACTTTGTCCAAAGTGTTGACATCGCTGCGTTCAACA
AAATCTAAGGGGTAACATATAATTTTTCAATTCACGATCGGATTTGCCGC
ATTACAAATGTGTTTGGGAGTCGTCTAAATAAATATTTTGATAAAAACCA
AAAAAAAAAAAAAAAAAAAAA

LD01705.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:27:32
Subject Length Description Subject Range Query Range Score Percent Strand
eEF1delta-RB 1246 eEF1delta-RB 259..1159 1..901 4505 100 Plus
eEF1delta-RA 1165 eEF1delta-RA 380..1078 203..901 3495 100 Plus
eEF1delta-RA 1165 eEF1delta-RA 259..382 1..124 620 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:37:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 10232606..10233301 204..899 3480 100 Plus
chr2L 23010047 chr2L 10231387..10231514 1..128 640 100 Plus
chr2L 23010047 chr2L 10232329..10232412 122..205 420 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:48:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:37:17
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10233755..10234452 204..901 3490 100 Plus
2L 23513712 2L 10232536..10232663 1..128 640 100 Plus
2L 23513712 2L 10233478..10233561 122..205 420 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:04:23
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10233755..10234452 204..901 3490 100 Plus
2L 23513712 2L 10232536..10232663 1..128 640 100 Plus
2L 23513712 2L 10233478..10233561 122..205 420 100 Plus
Blast to na_te.dros performed on 2019-03-16 07:37:18 has no hits.

LD01705.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:38:25 Download gff for LD01705.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 10231387..10231510 1..124 100 -> Plus
chr2L 10232332..10232412 125..205 100 -> Plus
chr2L 10232608..10233301 206..899 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:29:59 Download gff for LD01705.complete
Subject Subject Range Query Range Percent Splice Strand
eEF1delta-RB 1..771 38..808 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:58:16 Download gff for LD01705.complete
Subject Subject Range Query Range Percent Splice Strand
eEF1delta-RB 1..771 38..808 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:33:16 Download gff for LD01705.complete
Subject Subject Range Query Range Percent Splice Strand
eEF1delta-RB 1..771 38..808 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:49:03 Download gff for LD01705.complete
Subject Subject Range Query Range Percent Splice Strand
eEF1delta-RB 1..771 38..808 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:38:04 Download gff for LD01705.complete
Subject Subject Range Query Range Percent Splice Strand
eEF1delta-RB 1..771 38..808 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:14:44 Download gff for LD01705.complete
Subject Subject Range Query Range Percent Splice Strand
eEF1delta-RB 26..924 1..899 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:58:16 Download gff for LD01705.complete
Subject Subject Range Query Range Percent Splice Strand
eEF1delta-RB 44..942 1..899 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:33:16 Download gff for LD01705.complete
Subject Subject Range Query Range Percent Splice Strand
eEF1delta-RB 30..928 1..899 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:49:04 Download gff for LD01705.complete
Subject Subject Range Query Range Percent Splice Strand
eEF1delta-RB 26..924 1..899 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:38:04 Download gff for LD01705.complete
Subject Subject Range Query Range Percent Splice Strand
eEF1delta-RB 30..928 1..899 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:38:25 Download gff for LD01705.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10232536..10232659 1..124 100 -> Plus
2L 10233481..10233561 125..205 100 -> Plus
2L 10233757..10234450 206..899 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:38:25 Download gff for LD01705.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10232536..10232659 1..124 100 -> Plus
2L 10233481..10233561 125..205 100 -> Plus
2L 10233757..10234450 206..899 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:38:25 Download gff for LD01705.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10232536..10232659 1..124 100 -> Plus
2L 10233481..10233561 125..205 100 -> Plus
2L 10233757..10234450 206..899 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:33:16 Download gff for LD01705.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10232536..10232659 1..124 100 -> Plus
arm_2L 10233481..10233561 125..205 100 -> Plus
arm_2L 10233757..10234450 206..899 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:20:29 Download gff for LD01705.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10233757..10234450 206..899 100   Plus
2L 10232536..10232659 1..124 100 -> Plus
2L 10233481..10233561 125..205 100 -> Plus

LD01705.hyp Sequence

Translation from 0 to 807

> LD01705.hyp
TCLSKSAGERLKMKVEALDKFWADKSRYDLAEKRFYEGPQKVTDRSHYSP
LVSEIAKAREHIQNSLEKIDGVTLDDGLNSELAKRLAQLEGEHKELKTQV
SLLNELLTATVKRLETQLKLTNGVSKEPEVEAKKPEANDDDDDVDLFGSD
SEEEDGEAARIREERLAAYAAKKAKKVQIIAKSNIILDVKPWDDETDLKV
METEIRKITQDGLLWGASKFVPVAFGIQKLSISCVVEDDKVSIDWLTEEI
EKLEDFVQSVDIAAFNKI*

LD01705.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:23:48
Subject Length Description Subject Range Query Range Score Percent Strand
eEF1delta-PB 256 CG4912-PB 1..256 13..268 1287 100 Plus
eEF1delta-PA 229 CG4912-PA 1..229 13..268 1114 89.5 Plus
Ef1beta-PC 222 CG6341-PC 82..222 127..268 506 70.4 Plus
Ef1beta-PB 222 CG6341-PB 82..222 127..268 506 70.4 Plus

LD01705.pep Sequence

Translation from 37 to 807

> LD01705.pep
MKVEALDKFWADKSRYDLAEKRFYEGPQKVTDRSHYSPLVSEIAKAREHI
QNSLEKIDGVTLDDGLNSELAKRLAQLEGEHKELKTQVSLLNELLTATVK
RLETQLKLTNGVSKEPEVEAKKPEANDDDDDVDLFGSDSEEEDGEAARIR
EERLAAYAAKKAKKVQIIAKSNIILDVKPWDDETDLKVMETEIRKITQDG
LLWGASKFVPVAFGIQKLSISCVVEDDKVSIDWLTEEIEKLEDFVQSVDI
AAFNKI*

LD01705.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:11:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15753-PA 254 GF15753-PA 1..254 1..256 948 77 Plus
Dana\GF11416-PA 222 GF11416-PA 101..222 134..256 406 72.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:11:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10094-PA 261 GG10094-PA 1..261 1..256 1054 92 Plus
Dere\GG20637-PA 222 GG20637-PA 101..222 134..256 373 71.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:11:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13553-PA 252 GH13553-PA 1..252 6..256 663 57.5 Plus
Dgri\GH22643-PA 219 GH22643-PA 98..219 134..256 399 70.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:27:20
Subject Length Description Subject Range Query Range Score Percent Strand
eEF1delta-PB 256 CG4912-PB 1..256 1..256 1287 100 Plus
eEF1delta-PA 229 CG4912-PA 1..229 1..256 1114 89.5 Plus
eEF1beta-PC 222 CG6341-PC 82..222 115..256 506 70.4 Plus
eEF1beta-PB 222 CG6341-PB 82..222 115..256 506 70.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:11:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21156-PA 222 GI21156-PA 101..222 134..256 399 70.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:11:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18972-PA 247 GL18972-PA 1..247 1..256 810 67.6 Plus
Dper\GL16653-PA 197 GL16653-PA 75..197 134..256 448 69.1 Plus
Dper\GL11563-PA 223 GL11563-PA 101..223 134..256 430 71.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:11:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18520-PA 218 GA18520-PA 1..218 30..256 706 67.8 Plus
Dpse\GA24772-PA 223 GA24772-PA 101..223 134..256 430 71.5 Plus
Dpse\GA27792-PA 71 GA27792-PA 1..71 186..256 259 70.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:11:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18026-PA 259 GM18026-PA 1..259 1..256 1089 94.2 Plus
Dsec\GM21730-PA 222 GM21730-PA 101..222 134..256 373 71.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:11:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23666-PA 259 GD23666-PA 1..259 1..256 1093 95 Plus
Dsim\GD11225-PA 222 GD11225-PA 101..222 134..256 373 71.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:11:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21006-PA 222 GJ21006-PA 101..222 134..256 395 71.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:11:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22024-PA 222 GK22024-PA 101..222 134..256 372 71.5 Plus
Dwil\GK24092-PA 68 GK24092-PA 1..68 189..256 318 91.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:11:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\eEF1delta-PA 261 GE18908-PA 1..261 1..256 1040 90.4 Plus
Dyak\Ef1beta-PA 222 GE11826-PA 101..222 134..256 371 71.5 Plus