Clone LD02334 Report

Search the DGRC for LD02334

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:23
Well:34
Vector:pBS SK-
Associated Gene/TranscriptCam-RA
Protein status:LD02334.pep: gold
Preliminary Size:1010
Sequenced Size:837

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8472 2003-01-01 Sim4 clustering to Release 3
CG8472 2003-01-16 Blastp of sequenced clone
Cam 2008-04-29 Release 5.5 accounting
Cam 2008-08-15 Release 5.9 accounting
Cam 2008-12-18 5.12 accounting

Clone Sequence Records

LD02334.complete Sequence

837 bp (837 high quality bases) assembled on 2003-01-16

GenBank Submission: BT003282

> LD02334.complete
AAGTAAAACAGCTGTGGGAAAAGCGCGCTTGGCCAAAAGCAAAGTGGCGG
TTGAATAATTTGTTTCTCGACCAACGAGCGCACGGATGCGTGCAGACTGA
CGGTGTGTTAATTTAGTAAAATATAAAGTTAACCGCGCGTTCCGTAATTC
CACTCACACACATACCAACACCCAAGCAGCAGCAGTAGCCGCAGCGGATT
AAAACTTCGTCACTCTAGCAACAAACAGAAAAAAAAAACACCTACAAAAA
TGGCCGATCAGCTGACAGAGGAACAGATCGCCGAGTTCAAAGAGGCATTC
TCGCTATTCGACAAAGACGGCGATGGCACCATCACAACAAAGGAGTTGGG
CACAGTTATGCGCTCCCTGGGCCAGAATCCCACAGAGGCCGAGCTGCAGG
ACATGATCAACGAGGTTGATGCCGACGGCAACGGCACAATTGACTTCCCT
GAATTCCTTACCATGATGGCACGCAAAATGAAGGACACCGATAGCGAAGA
GGAGATCCGAGAAGCCTTCAGAGTGTTCGACAAGGATGGCAACGGCTTCA
TCTCGGCGGCCGAGTTGCGTCACGTGATGACAAATCTGGGCGAGAAACTC
ACAGACGAGGAGGTCGATGAGATGATCCGGGAGGCTGATATCGATGGCGA
CGGTCAGGTCAATTACGAAGAATTCGTGACTATGATGACATCGAAGTGAA
GCGTTAAATTATTTCTTTTTAAGCCTTTCTATTTTTTTAAGATGTTGACG
AAGACTGTAGCTGTGCGCAATAACATCGCGCCACGCTGTTGCTATGGACC
CCAGTAAAAGATCTTAAAAAAAAAAAAAAAAAAAAAA

LD02334.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:25:12
Subject Length Description Subject Range Query Range Score Percent Strand
Cam.a 1496 Cam.a 70..803 104..837 3640 99.7 Plus
Cam.i 2073 Cam.i 71..804 104..837 3640 99.7 Plus
Cam.d 2245 Cam.d 71..804 104..837 3640 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:15:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8156411..8156654 427..670 1205 99.6 Plus
chr2R 21145070 chr2R 8151967..8152143 252..428 885 100 Plus
chr2R 21145070 chr2R 8147254..8147404 103..253 755 100 Plus
chr2R 21145070 chr2R 8160973..8161119 669..815 735 100 Plus
chr2R 21145070 chr2R 12108992..12109094 103..1 515 100 Minus
chr3R 27901430 chr3R 21635935..21636038 574..677 235 81.7 Plus
chrX 22417052 chrX 5512363..5512454 617..526 190 80.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:48:49 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:15:53
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12269192..12269435 427..670 1220 100 Plus
2R 25286936 2R 12264742..12264918 252..428 885 100 Plus
2R 25286936 2R 12273764..12273932 669..837 815 98.8 Plus
2R 25286936 2R 12260039..12260189 103..253 755 100 Plus
2R 25286936 2R 16221670..16221772 103..1 515 100 Minus
3R 32079331 3R 25812965..25813068 574..677 235 81.7 Plus
X 23542271 X 5619953..5620044 617..526 190 80.4 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:02:43
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12270391..12270634 427..670 1220 100 Plus
2R 25260384 2R 12265941..12266117 252..428 885 100 Plus
2R 25260384 2R 12274963..12275131 669..837 815 98.8 Plus
2R 25260384 2R 12261238..12261388 103..253 755 100 Plus
2R 25260384 2R 16222869..16222971 103..1 515 100 Minus
3R 31820162 3R 25553796..25553899 574..677 235 81.7 Plus
X 23527363 X 5628051..5628142 617..526 190 80.4 Minus
3R 31820162 3R 25553565..25553620 343..398 160 85.7 Plus
Blast to na_te.dros performed on 2019-03-16 08:15:54 has no hits.

LD02334.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:16:39 Download gff for LD02334.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8147254..8147403 103..252 100 -> Plus
chr2R 8151968..8152142 253..427 100 -> Plus
chr2R 8156412..8156654 428..670 99 -> Plus
chr2R 8160975..8161119 671..815 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:28:12 Download gff for LD02334.complete
Subject Subject Range Query Range Percent Splice Strand
Cam-RB 1..450 250..699 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:55:42 Download gff for LD02334.complete
Subject Subject Range Query Range Percent Splice Strand
Cam-RC 1..450 250..699 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:47:06 Download gff for LD02334.complete
Subject Subject Range Query Range Percent Splice Strand
Cam-RB 1..450 250..699 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:46:42 Download gff for LD02334.complete
Subject Subject Range Query Range Percent Splice Strand
Cam-RB 1..450 250..699 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:38:27 Download gff for LD02334.complete
Subject Subject Range Query Range Percent Splice Strand
Cam-RE 1..450 250..699 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:28:11 Download gff for LD02334.complete
Subject Subject Range Query Range Percent Splice Strand
Cam-RA 52..763 104..815 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:55:42 Download gff for LD02334.complete
Subject Subject Range Query Range Percent Splice Strand
Cam-RC 52..763 104..815 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:47:06 Download gff for LD02334.complete
Subject Subject Range Query Range Percent Splice Strand
Cam-RA 62..773 104..815 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:46:42 Download gff for LD02334.complete
Subject Subject Range Query Range Percent Splice Strand
Cam-RA 52..763 104..815 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:38:27 Download gff for LD02334.complete
Subject Subject Range Query Range Percent Splice Strand
Cam-RE 4..720 98..815 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:16:39 Download gff for LD02334.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12260039..12260188 103..252 100 -> Plus
2R 12264743..12264917 253..427 100 -> Plus
2R 12269193..12269435 428..670 100 -> Plus
2R 12273766..12273910 671..815 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:16:39 Download gff for LD02334.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12260039..12260188 103..252 100 -> Plus
2R 12264743..12264917 253..427 100 -> Plus
2R 12269193..12269435 428..670 100 -> Plus
2R 12273766..12273910 671..815 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:16:39 Download gff for LD02334.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12260039..12260188 103..252 100 -> Plus
2R 12264743..12264917 253..427 100 -> Plus
2R 12269193..12269435 428..670 100 -> Plus
2R 12273766..12273910 671..815 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:47:06 Download gff for LD02334.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8147544..8147693 103..252 100 -> Plus
arm_2R 8152248..8152422 253..427 100 -> Plus
arm_2R 8156698..8156940 428..670 100 -> Plus
arm_2R 8161271..8161415 671..815 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:17:50 Download gff for LD02334.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12270392..12270634 428..670 100 -> Plus
2R 12274965..12275109 671..815 100   Plus
2R 12261238..12261387 103..252 100 -> Plus
2R 12265942..12266116 253..427 100 -> Plus

LD02334.pep Sequence

Translation from 249 to 698

> LD02334.pep
MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQ
DMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGF
ISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVTMMTSK*

LD02334.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:32:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12835-PA 149 GF12835-PA 1..149 1..149 761 100 Plus
Dana\GF16772-PA 148 GF16772-PA 4..148 5..149 553 71.7 Plus
Dana\GF13647-PA 148 GF13647-PA 2..148 3..149 423 51.7 Plus
Dana\GF16771-PA 165 GF16771-PA 18..163 2..147 351 44.5 Plus
Dana\GF13648-PA 151 GF13648-PA 15..146 12..143 346 50.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:32:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20265-PA 149 GG20265-PA 1..149 1..149 761 100 Plus
Dere\GG11425-PA 148 GG11425-PA 3..148 4..149 538 68.5 Plus
Dere\GG23316-PA 148 GG23316-PA 1..148 1..149 440 55 Plus
Dere\GG24968-PA 148 GG24968-PA 2..148 3..149 400 55.8 Plus
Dere\GG21382-PA 182 GG21382-PA 34..176 4..146 335 49.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:32:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23405-PA 151 GH23405-PA 1..151 1..149 520 65.6 Plus
Dgri\GH22800-PA 122 GH22800-PA 5..104 2..101 513 100 Plus
Dgri\GH13759-PA 147 GH13759-PA 8..147 10..149 349 47.1 Plus
Dgri\GH10976-PA 190 GH10976-PA 42..184 4..146 341 50.3 Plus
Dgri\GH21304-PA 151 GH21304-PA 8..147 5..144 340 44.3 Plus
Dgri\GH22800-PA 122 GH22800-PA 15..79 85..149 163 49.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:11:29
Subject Length Description Subject Range Query Range Score Percent Strand
Cam-PD 149 CG8472-PD 1..149 1..149 758 100 Plus
Cam-PC 149 CG8472-PC 1..149 1..149 758 100 Plus
Cam-PE 149 CG8472-PE 1..149 1..149 758 100 Plus
Cam-PB 149 CG8472-PB 1..149 1..149 758 100 Plus
Cam-PA 149 CG8472-PA 1..149 1..149 758 100 Plus
Acam-PB 148 CG17769-PB 3..148 4..149 536 67.8 Plus
Acam-PA 148 CG17769-PA 3..148 4..149 536 67.8 Plus
CG31960-PA 148 CG31960-PA 2..148 3..149 439 56.5 Plus
azot-PA 148 CG11165-PA 2..148 3..149 431 52.4 Plus
CG11638-PA 387 CG11638-PA 206..352 5..143 380 49.7 Plus
TpnC41C-PB 154 CG2981-PB 1..150 1..147 347 44.7 Plus
TpnC41C-PA 154 CG2981-PA 1..150 1..147 347 44.7 Plus
CG17493-PD 182 CG17493-PD 34..176 4..146 346 49.7 Plus
CG17493-PC 182 CG17493-PC 34..176 4..146 346 49.7 Plus
CG17493-PB 182 CG17493-PB 34..176 4..146 346 49.7 Plus
CG30378-PA 148 CG30378-PA 1..148 1..148 342 42.6 Plus
CG17770-PA 164 CG17770-PA 20..163 5..148 337 45.1 Plus
Mlc-c-PA 147 CG3201-PA 5..146 6..148 326 46.2 Plus
CG5024-PB 165 CG5024-PB 21..162 5..146 317 41.5 Plus
CG5024-PA 165 CG5024-PA 21..162 5..146 317 41.5 Plus
TpnC73F-PC 155 CG7930-PC 6..155 3..149 309 40.7 Plus
TpnC73F-PA 155 CG7930-PA 6..155 3..149 309 40.7 Plus
TpnC47D-PB 155 CG9073-PB 6..155 3..149 305 40 Plus
TpnC47D-PA 155 CG9073-PA 6..155 3..149 305 40 Plus
Mlc-c-PB 153 CG3201-PB 15..152 10..148 304 44.7 Plus
CG31802-PA 186 CG31802-PA 39..180 5..146 303 43.7 Plus
CG13898-PA 151 CG13898-PA 8..151 5..148 297 39.6 Plus
CG13526-PA 154 CG13526-PA 7..152 3..148 278 34.2 Plus
sqh-PE 174 CG3595-PE 30..164 7..146 276 40.7 Plus
sqh-PD 174 CG3595-PD 30..164 7..146 276 40.7 Plus
sqh-PC 174 CG3595-PC 30..164 7..146 276 40.7 Plus
sqh-PB 174 CG3595-PB 30..164 7..146 276 40.7 Plus
sqh-PA 174 CG3595-PA 30..164 7..146 276 40.7 Plus
Eip63F-1-PC 181 CG15855-PC 21..180 6..146 272 35.6 Plus
Eip63F-1-PA 193 CG15855-PA 33..192 6..146 272 35.6 Plus
TpnC25D-PC 149 CG6514-PC 4..149 7..149 270 34.2 Plus
TpnC25D-PA 149 CG6514-PA 4..149 7..149 270 34.2 Plus
TpnC4-PB 153 CG12408-PB 1..152 1..147 269 35.5 Plus
TpnC4-PA 153 CG12408-PA 1..152 1..147 269 35.5 Plus
TpnC25D-PB 143 CG6514-PB 5..143 14..149 266 35.3 Plus
Eip63F-1-PD 166 CG15855-PD 9..165 9..146 266 35 Plus
Eip63F-1-PB 161 CG15855-PB 9..160 14..146 257 35.5 Plus
Mlc2-PA 222 CG2184-PA 73..213 6..149 221 35.4 Plus
CG17272-PA 149 CG17272-PA 1..138 1..143 219 37.1 Plus
CanB2-PB 170 CG11217-PB 11..157 1..146 193 31.8 Plus
CanB2-PA 170 CG11217-PA 11..157 1..146 193 31.8 Plus
CG33098-PD 164 CG33098-PD 11..156 4..147 190 30 Plus
CanB-PB 170 CG4209-PB 11..157 1..146 190 31.8 Plus
CanB-PA 170 CG4209-PA 11..157 1..146 190 31.8 Plus
CG33098-PF 230 CG33098-PF 77..222 4..147 190 30 Plus
CG33098-PE 230 CG33098-PE 77..222 4..147 190 30 Plus
CG11638-PA 387 CG11638-PA 190..276 59..148 183 44.4 Plus
TpnC73F-PC 155 CG7930-PC 80..152 1..73 161 43.8 Plus
TpnC73F-PA 155 CG7930-PA 80..152 1..73 161 43.8 Plus
TpnC25D-PB 143 CG6514-PB 79..141 12..74 159 46 Plus
CG11638-PA 387 CG11638-PA 289..367 7..85 156 36.7 Plus
CG30378-PA 148 CG30378-PA 11..76 84..149 146 40.9 Plus
CG17493-PD 182 CG17493-PD 107..178 1..75 138 41.3 Plus
CG17493-PC 182 CG17493-PC 107..178 1..75 138 41.3 Plus
CG17493-PB 182 CG17493-PB 107..178 1..75 138 41.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:32:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20594-PA 149 GI20594-PA 1..149 1..149 761 100 Plus
Dmoj\GI10339-PA 149 GI10339-PA 1..149 1..149 536 66.4 Plus
Dmoj\GI10340-PA 150 GI10340-PA 6..150 5..149 483 61.4 Plus
Dmoj\GI17900-PA 147 GI17900-PA 2..147 4..149 366 50 Plus
Dmoj\GI14487-PA 147 GI14487-PA 2..147 4..149 362 49.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:32:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10814-PA 149 GL10814-PA 1..149 1..149 761 100 Plus
Dper\GL21535-PA 148 GL21535-PA 3..148 4..149 579 74 Plus
Dper\GL21536-PA 148 GL21536-PA 3..148 4..149 551 69.9 Plus
Dper\GL11701-PA 148 GL11701-PA 4..148 5..149 447 57.2 Plus
Dper\GL11703-PA 149 GL11703-PA 3..147 2..146 438 58.6 Plus
Dper\GL11703-PA 149 GL11703-PA 9..77 81..149 167 47.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:32:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24499-PA 149 GA24499-PA 1..149 1..149 761 100 Plus
Dpse\GA14657-PA 148 GA14657-PA 3..148 4..149 578 74 Plus
Dpse\GA26322-PA 148 GA26322-PA 3..148 4..149 551 69.9 Plus
Dpse\GA24239-PA 149 GA24239-PA 3..149 2..148 447 58.5 Plus
Dpse\GA10810-PA 148 GA10810-PA 4..148 5..149 447 56.6 Plus
Dpse\GA24239-PA 149 GA24239-PA 9..77 81..149 167 47.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:32:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21351-PA 149 GM21351-PA 1..149 1..149 761 100 Plus
Dsec\GM10265-PA 148 GM10265-PA 3..148 4..149 537 67.8 Plus
Dsec\GM20994-PA 148 GM20994-PA 4..148 5..149 420 51.7 Plus
Dsec\GM18437-PA 148 GM18437-PA 2..148 3..149 384 53.7 Plus
Dsec\GM10264-PA 164 GM10264-PA 20..163 5..148 338 44.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:32:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10849-PA 149 GD10849-PA 1..149 1..149 761 100 Plus
Dsim\GD21235-PA 148 GD21235-PA 3..148 4..149 537 67.8 Plus
Dsim\GD10523-PA 148 GD10523-PA 1..148 1..149 422 52.3 Plus
Dsim\GD23255-PA 148 GD23255-PA 2..148 3..149 384 53.7 Plus
Dsim\GD10524-PA 117 GD10524-PA 1..117 33..149 368 54.7 Plus
Dsim\GD10524-PA 117 GD10524-PA 53..117 12..76 143 43.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:32:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20779-PA 113 GJ20779-PA 1..113 37..149 583 100 Plus
Dvir\GJ10193-PA 151 GJ10193-PA 7..151 5..149 527 67.6 Plus
Dvir\GJ15116-PA 151 GJ15116-PA 3..147 4..148 429 54.5 Plus
Dvir\GJ11809-PA 147 GJ11809-PA 3..147 5..149 413 54.5 Plus
Dvir\GJ15117-PA 152 GJ15117-PA 9..148 5..144 365 48.6 Plus
Dvir\GJ20779-PA 113 GJ20779-PA 41..113 1..76 165 47.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:32:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22183-PA 149 GK22183-PA 1..149 1..149 761 100 Plus
Dwil\GK18988-PA 148 GK18988-PA 3..148 4..149 602 76 Plus
Dwil\GK19414-PA 148 GK19414-PA 2..147 3..148 444 54.8 Plus
Dwil\GK21454-PA 151 GK21454-PA 7..151 5..149 394 51 Plus
Dwil\GK21975-PA 147 GK21975-PA 3..142 4..143 371 52.1 Plus
Dwil\GK21975-PA 147 GK21975-PA 10..75 84..149 140 40.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:32:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Cam-PA 149 GE12425-PA 1..149 1..149 761 100 Plus
Dyak\GE23620-PA 148 GE23620-PA 3..148 4..149 543 69.2 Plus
Dyak\GE19161-PA 148 GE19161-PA 1..148 1..149 437 53.7 Plus
Dyak\GE18259-PA 148 GE18259-PA 2..148 3..149 421 53.1 Plus
Dyak\GE23619-PA 164 GE23619-PA 17..163 2..148 340 43.5 Plus

LD02334.hyp Sequence

Translation from 249 to 698

> LD02334.hyp
MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQ
DMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGF
ISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVTMMTSK*

LD02334.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:25:54
Subject Length Description Subject Range Query Range Score Percent Strand
Cam-PD 149 CG8472-PD 1..149 1..149 758 100 Plus
Cam-PC 149 CG8472-PC 1..149 1..149 758 100 Plus
Cam-PE 149 CG8472-PE 1..149 1..149 758 100 Plus
Cam-PB 149 CG8472-PB 1..149 1..149 758 100 Plus
Cam-PA 149 CG8472-PA 1..149 1..149 758 100 Plus