Clone LD02427 Report

Search the DGRC for LD02427

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:24
Well:27
Vector:pBS SK-
Associated Gene/TranscriptCG5727-RA
Protein status:LD02427.pep: gold
Preliminary Size:904
Sequenced Size:721

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5727 2001-01-01 Release 2 assignment
CG5727 2002-06-10 Blastp of sequenced clone
CG5727 2003-01-01 Sim4 clustering to Release 3
CG5727 2008-04-29 Release 5.5 accounting
CG5727 2008-08-15 Release 5.9 accounting
CG5727 2008-12-18 5.12 accounting

Clone Sequence Records

LD02427.complete Sequence

721 bp (721 high quality bases) assembled on 2002-06-10

GenBank Submission: AY121638

> LD02427.complete
AGACCATGAAGTCCGAGAAACTGAAACGAAACTTTTGGGTCTCCGCCGAA
ATAGAGTGCATGCTCGACCTGATTAAGGAGGTGAACAACTGCCAGGGAGC
CCTGTCCACCAGCACCACCCAGTACACCTTCATCCAAATCGCCAATCAGA
TGAAAAAAAGGGGTTTTCCAAACAAGTCGCCCACCCAAATACGCAGAAAA
TGGTTTCAAATGAAGAGCGCCTATCTGTGTTACAAAAAGGGAAATGTTGA
TCGACTATTTCTGATACCCGAGAAATTCCGCAACGCCATCGCTGAGTTCG
TAGAAAGTGGCGAGAAAATCGGACGTTCCAATCTATCCACCATTTCAAGT
GGAACCCCAGCTATCGTGCAGCAAAATCAGGAAGTACACTCAGAGGAAGA
CACTTCGCCCATGGATATATTCCTGAATCAGATCCGTAAAAACAATAAAA
TGATTAATTCGGAGTTCTTTAGGATGGAAGAATCGTTACAGCAATTCGAA
CAGAAATGCCAGTTTATTAGAGACAAAAACATAGCCAAGCTCATCGATGG
TTATTAGCCAAATAAATATACAAATTCCAGATATATAGTAAATAAGTTTT
AATAAAATGTAAGCAAAACTGATATATTTTTTGTTTATTTCGTATATAAT
GCATTGTTGTAAAGGTAGAAACACAATAAATGAGCACTTTATCACATATA
AAAAAAAAAAAAAAAAAAAAA

LD02427.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:04:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG5727-RA 822 CG5727-RA 106..805 1..700 3500 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:11:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 10209076..10209459 384..1 1920 100 Minus
chr2L 23010047 chr2L 10208704..10209020 699..383 1585 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:48:56 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:11:49
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10210225..10210608 384..1 1920 100 Minus
2L 23513712 2L 10209852..10210169 700..383 1590 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:47:02
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10210225..10210608 384..1 1920 100 Minus
2L 23513712 2L 10209852..10210169 700..383 1590 100 Minus
Blast to na_te.dros performed 2019-03-15 19:11:49
Subject Length Description Subject Range Query Range Score Percent Strand
mdg1 7480 mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). 6845..6990 561..698 153 59.6 Plus
Dvir\Tv1 6868 Dvir\Tv1 6868bp Derived from AF056940 (Rel. 62, Last updated, Version 4). 1477..1533 298..352 109 68.4 Plus
Dbuz\ISBu2 726 Dbuz\ISBu2 ISBU2 726bp 251..516 688..437 108 54.8 Minus

LD02427.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:12:45 Download gff for LD02427.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 10208704..10209018 385..699 100 <- Minus
chr2L 10209076..10209459 1..384 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:30:52 Download gff for LD02427.complete
Subject Subject Range Query Range Percent Splice Strand
CG5727-RA 1..552 6..557 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:32:32 Download gff for LD02427.complete
Subject Subject Range Query Range Percent Splice Strand
CG5727-RA 1..552 6..557 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:45:45 Download gff for LD02427.complete
Subject Subject Range Query Range Percent Splice Strand
CG5727-RA 1..552 6..557 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:24:30 Download gff for LD02427.complete
Subject Subject Range Query Range Percent Splice Strand
CG5727-RA 1..552 6..557 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:13:30 Download gff for LD02427.complete
Subject Subject Range Query Range Percent Splice Strand
CG5727-RA 1..552 6..557 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:48:38 Download gff for LD02427.complete
Subject Subject Range Query Range Percent Splice Strand
CG5727-RA 62..760 1..699 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:32:32 Download gff for LD02427.complete
Subject Subject Range Query Range Percent Splice Strand
CG5727-RA 93..791 1..699 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:45:45 Download gff for LD02427.complete
Subject Subject Range Query Range Percent Splice Strand
CG5727-RA 74..772 1..699 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:24:30 Download gff for LD02427.complete
Subject Subject Range Query Range Percent Splice Strand
CG5727-RA 62..760 1..699 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:13:30 Download gff for LD02427.complete
Subject Subject Range Query Range Percent Splice Strand
CG5727-RA 74..772 1..699 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:12:45 Download gff for LD02427.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10209853..10210167 385..699 100 <- Minus
2L 10210225..10210608 1..384 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:12:45 Download gff for LD02427.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10209853..10210167 385..699 100 <- Minus
2L 10210225..10210608 1..384 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:12:45 Download gff for LD02427.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10209853..10210167 385..699 100 <- Minus
2L 10210225..10210608 1..384 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:45:45 Download gff for LD02427.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10209853..10210167 385..699 100 <- Minus
arm_2L 10210225..10210608 1..384 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:53:22 Download gff for LD02427.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10209853..10210167 385..699 100 <- Minus
2L 10210225..10210608 1..384 100   Minus

LD02427.hyp Sequence

Translation from 2 to 556

> LD02427.hyp
TMKSEKLKRNFWVSAEIECMLDLIKEVNNCQGALSTSTTQYTFIQIANQM
KKRGFPNKSPTQIRRKWFQMKSAYLCYKKGNVDRLFLIPEKFRNAIAEFV
ESGEKIGRSNLSTISSGTPAIVQQNQEVHSEEDTSPMDIFLNQIRKNNKM
INSEFFRMEESLQQFEQKCQFIRDKNIAKLIDGY*

LD02427.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:26:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG5727-PA 183 CG5727-PA 1..183 2..184 947 100 Plus

LD02427.pep Sequence

Translation from 5 to 556

> LD02427.pep
MKSEKLKRNFWVSAEIECMLDLIKEVNNCQGALSTSTTQYTFIQIANQMK
KRGFPNKSPTQIRRKWFQMKSAYLCYKKGNVDRLFLIPEKFRNAIAEFVE
SGEKIGRSNLSTISSGTPAIVQQNQEVHSEEDTSPMDIFLNQIRKNNKMI
NSEFFRMEESLQQFEQKCQFIRDKNIAKLIDGY*

LD02427.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:40:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19657-PA 193 GF19657-PA 1..192 1..181 754 76.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:40:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23971-PA 186 GG23971-PA 1..182 1..182 923 95.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:40:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13550-PA 185 GH13550-PA 1..183 1..180 532 59.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:27:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG5727-PA 183 CG5727-PA 1..183 1..183 947 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:40:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18689-PA 177 GI18689-PA 1..177 1..182 552 56 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:40:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10052-PA 175 GL10052-PA 1..175 1..181 601 64.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:40:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19087-PA 175 GA19087-PA 1..175 1..181 598 64.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:40:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11944-PA 183 GM11944-PA 1..183 1..183 958 98.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:40:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22295-PA 183 GD22295-PA 1..183 1..183 958 98.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:40:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17537-PA 177 GJ17537-PA 1..177 1..182 499 58.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:40:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18995-PA 185 GK18995-PA 1..184 1..181 530 57.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:40:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26339-PA 183 GE26339-PA 1..183 1..183 921 93.4 Plus