Clone LD02616 Report

Search the DGRC for LD02616

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:26
Well:16
Vector:pBS SK-
Associated Gene/TranscriptTango2-RA
Protein status:LD02616.pep: gold
Preliminary Size:1548
Sequenced Size:1444

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11176 2001-01-01 Release 2 assignment
CG11176 2001-11-02 Blastp of sequenced clone
CG11176 2003-01-01 Sim4 clustering to Release 3
Tango2 2008-04-29 Release 5.5 accounting
Tango2 2008-08-15 Release 5.9 accounting
Tango2 2008-12-18 5.12 accounting

Clone Sequence Records

LD02616.complete Sequence

1444 bp (1444 high quality bases) assembled on 2001-11-02

GenBank Submission: AY069312

> LD02616.complete
AGAAATCAAAACAAGGCAACCCGGTCATTGAAATTTCAGAAAATACTGCT
TTGTTTGCGTTAACGGGAATGCTTTTTGCCCCGTAGATATGTATATATCA
CATAGAGGCACGGCTCACAGAGAACACCCACCAATCCAAACCATTTACAT
TTACCACTTAGATTAGCTGGTCTCGCAAACAACGGATAAGACTGTATATC
AGCTGTACGTACGTACGGCTATTTGGTGATAAAACCGGCGCTATAGTTCC
ACTGCCACAAAGTAACAAAGAGAAGACTGAGCCGAACAACCTGCCATTTT
GATACCGACGCCCCACCGAGATTAAAGCCCACTTTTCCGGATCCCATTCG
CAGTTGTCCCACAACCTCAAGGCACTACAAATCGCAACAATAGCCAAATA
AGTATAGGATTCCGACGATGTGCGTGATATTCTTTTGTGCGGACTCGAAT
CCGCAACCGGGTGGCTACAAGCTCATCCTGGCCTCCAATCGGGACGAGTT
CTTTGCCCGCGCCACCCTATCGGCAGCCAAGTGGGCGAATGCCGATCATG
TTTACGGAGGGATCGATCTGGAGCCGGGACGCGAGGGCGGCACCTGGCTG
GCGATCGGCCACTCCGCTGGCTTCTTTAAGGTGGGCGCCCTGCTCAATCT
GACCGGCGAGCCCAAGCCACGCGATGCAGTTGGGCGCGGCATGATTGTGG
CGGACTATGTTACCCGGGCGGACGAGGAGCACAGCATCCTGAACTACAAC
GAAAGGCTGCTCAAAGATTGCACCAAGTATTCTGCCTTCAACTTTGTGTC
CATCGAAATTGGATCTGCATCCCAGCCCGCTCGCGTGAAGCTGCTGAGCA
ATGTGCCGCCCACGCTGGAGGATTTCCAGAACGGCGAGTGCTACGGATTT
GGCAACAGTCTGCCGCACTCTCCGTTCGAGAAGGTGCGTCATGGCAAACA
GGAGTTCGAGGCGATCGTTAAGGCTCATGGGGAAGCCAGCGTGGAGACTC
TGTCCGCCCAGCTGATGCAGTTGCTCCGCAACAAGCACAAATTCTGGCCG
GACGACGAGCTAAAGACACGTGCGCCCAACTGGGGCGAGGGATTGAGTTC
CCTAAACGTCCATATCGAAGAGCATGCCTATGGCAGCCGTACACACTCCG
TTGTCCTGGTGGACAGCGAGAATAAGATGCACTTCATTGAGGAGACAATG
ACTGGATTGGATCCGCACGGCGAATGGAACAAGACCCACATTGAAAAGGA
TTTTCAAAACGGCGTTTGACCACGGACAGGATGACGCAACTTCTTGACGC
AACTATCTCGTTCGAAGACTTTCCTCTTTTGTAGAATAACCTAATTGGCT
AATATTCTACCAATCTGTATTTTGACTCTGGCATTTGCGATAATAAATAG
TCATATTTACTATATCTTTAAAGAAAAAAAAAAAAAAAAAAAAA

LD02616.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:01:52
Subject Length Description Subject Range Query Range Score Percent Strand
Tango2-RA 1547 Tango2-RA 83..1507 1..1425 7125 100 Plus
Tango2.a 1387 Tango2.a 118..1381 162..1425 6320 100 Plus
Tango2.a 1387 Tango2.a 28..117 1..90 450 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:40:11
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 13509332..13509943 812..1423 3060 100 Plus
chrX 22417052 chrX 13507753..13508312 1..560 2800 100 Plus
chrX 22417052 chrX 13509008..13509138 682..812 655 100 Plus
chrX 22417052 chrX 13508548..13508673 558..683 630 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:49:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:40:09
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 13618596..13619209 812..1425 3070 100 Plus
X 23542271 X 13617017..13617576 1..560 2800 100 Plus
X 23542271 X 13618272..13618402 682..812 655 100 Plus
X 23542271 X 13617812..13617937 558..683 630 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:26:34
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 13626694..13627307 812..1425 3070 100 Plus
X 23527363 X 13625115..13625674 1..560 2800 100 Plus
X 23527363 X 13626370..13626500 682..812 655 100 Plus
X 23527363 X 13625910..13626035 558..683 630 100 Plus
Blast to na_te.dros performed on 2019-03-15 21:40:09 has no hits.

LD02616.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:41:14 Download gff for LD02616.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 13507753..13508311 1..559 100 -> Plus
chrX 13508550..13508672 560..682 100 -> Plus
chrX 13509009..13509138 683..812 100 -> Plus
chrX 13509333..13509943 813..1423 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:31:13 Download gff for LD02616.complete
Subject Subject Range Query Range Percent Splice Strand
Tango2-RA 1..852 418..1269 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:35:41 Download gff for LD02616.complete
Subject Subject Range Query Range Percent Splice Strand
Tango2-RA 1..852 418..1269 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:55:17 Download gff for LD02616.complete
Subject Subject Range Query Range Percent Splice Strand
Tango2-RA 1..852 418..1269 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:04:21 Download gff for LD02616.complete
Subject Subject Range Query Range Percent Splice Strand
Tango2-RA 1..852 418..1269 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:00:02 Download gff for LD02616.complete
Subject Subject Range Query Range Percent Splice Strand
Tango2-RA 1..852 418..1269 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:15:44 Download gff for LD02616.complete
Subject Subject Range Query Range Percent Splice Strand
Tango2-RA 26..1448 1..1423 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:35:41 Download gff for LD02616.complete
Subject Subject Range Query Range Percent Splice Strand
Tango2-RA 26..1448 1..1423 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:55:17 Download gff for LD02616.complete
Subject Subject Range Query Range Percent Splice Strand
Tango2-RA 29..1451 1..1423 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:04:21 Download gff for LD02616.complete
Subject Subject Range Query Range Percent Splice Strand
Tango2-RA 26..1448 1..1423 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:00:02 Download gff for LD02616.complete
Subject Subject Range Query Range Percent Splice Strand
Tango2-RA 29..1451 1..1423 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:41:14 Download gff for LD02616.complete
Subject Subject Range Query Range Percent Splice Strand
X 13617017..13617575 1..559 100 -> Plus
X 13617814..13617936 560..682 100 -> Plus
X 13618273..13618402 683..812 100 -> Plus
X 13618597..13619207 813..1423 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:41:14 Download gff for LD02616.complete
Subject Subject Range Query Range Percent Splice Strand
X 13617017..13617575 1..559 100 -> Plus
X 13617814..13617936 560..682 100 -> Plus
X 13618273..13618402 683..812 100 -> Plus
X 13618597..13619207 813..1423 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:41:14 Download gff for LD02616.complete
Subject Subject Range Query Range Percent Splice Strand
X 13617017..13617575 1..559 100 -> Plus
X 13617814..13617936 560..682 100 -> Plus
X 13618273..13618402 683..812 100 -> Plus
X 13618597..13619207 813..1423 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:55:17 Download gff for LD02616.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 13511847..13511969 560..682 100 -> Plus
arm_X 13512306..13512435 683..812 100 -> Plus
arm_X 13511050..13511608 1..559 100 -> Plus
arm_X 13512630..13513240 813..1423 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:40:24 Download gff for LD02616.complete
Subject Subject Range Query Range Percent Splice Strand
X 13625115..13625673 1..559 100 -> Plus
X 13625912..13626034 560..682 100 -> Plus
X 13626371..13626500 683..812 100 -> Plus
X 13626695..13627305 813..1423 100   Plus

LD02616.hyp Sequence

Translation from 417 to 1268

> LD02616.hyp
MCVIFFCADSNPQPGGYKLILASNRDEFFARATLSAAKWANADHVYGGID
LEPGREGGTWLAIGHSAGFFKVGALLNLTGEPKPRDAVGRGMIVADYVTR
ADEEHSILNYNERLLKDCTKYSAFNFVSIEIGSASQPARVKLLSNVPPTL
EDFQNGECYGFGNSLPHSPFEKVRHGKQEFEAIVKAHGEASVETLSAQLM
QLLRNKHKFWPDDELKTRAPNWGEGLSSLNVHIEEHAYGSRTHSVVLVDS
ENKMHFIEETMTGLDPHGEWNKTHIEKDFQNGV*

LD02616.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:28:49
Subject Length Description Subject Range Query Range Score Percent Strand
Tango2-PC 283 CG11176-PC 1..283 1..283 1515 100 Plus
Tango2-PA 283 CG11176-PA 1..283 1..283 1515 100 Plus
Tango2-PD 340 CG11176-PD 1..340 1..283 1389 81.2 Plus
Tango2-PB 340 CG11176-PB 1..340 1..283 1389 81.2 Plus

LD02616.pep Sequence

Translation from 417 to 1268

> LD02616.pep
MCVIFFCADSNPQPGGYKLILASNRDEFFARATLSAAKWANADHVYGGID
LEPGREGGTWLAIGHSAGFFKVGALLNLTGEPKPRDAVGRGMIVADYVTR
ADEEHSILNYNERLLKDCTKYSAFNFVSIEIGSASQPARVKLLSNVPPTL
EDFQNGECYGFGNSLPHSPFEKVRHGKQEFEAIVKAHGEASVETLSAQLM
QLLRNKHKFWPDDELKTRAPNWGEGLSSLNVHIEEHAYGSRTHSVVLVDS
ENKMHFIEETMTGLDPHGEWNKTHIEKDFQNGV*

LD02616.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 11:33:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21807-PA 349 GF21807-PA 152..346 88..282 861 79.5 Plus
Dana\GF21807-PA 349 GF21807-PA 1..88 1..88 424 87.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 11:33:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17797-PA 334 GG17797-PA 1..334 1..283 1358 77.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 11:33:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11912-PA 282 GH11912-PA 1..277 1..277 1168 75.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:54
Subject Length Description Subject Range Query Range Score Percent Strand
Tango2-PC 283 CG11176-PC 1..283 1..283 1515 100 Plus
Tango2-PA 283 CG11176-PA 1..283 1..283 1515 100 Plus
Tango2-PD 340 CG11176-PD 1..340 1..283 1389 81.2 Plus
Tango2-PB 340 CG11176-PB 1..340 1..283 1389 81.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 11:33:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15520-PA 282 GI15520-PA 1..281 1..281 1145 75.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 11:33:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22571-PA 329 GL22571-PA 1..306 1..261 973 63.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 11:33:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10818-PA 326 GA10818-PA 1..303 1..261 974 63.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 11:33:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17622-PA 326 GM17622-PA 1..326 1..283 1448 85 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 11:33:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19277-PA 282 GJ19277-PA 1..281 1..281 1210 77.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 11:33:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10209-PA 277 GK10209-PA 1..277 1..279 1102 71.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 11:33:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17093-PA 330 GE17093-PA 1..330 1..283 1365 78.8 Plus